KEGG   Cucumis melo (muskmelon): 103499616Help
Entry
103499616         CDS       T03195                                 

Definition
(RefSeq) glutathione S-transferase 2-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00350  Tyrosine metabolism
cmo01100  Metabolic pathways
Module
cmo_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103499616
Enzymes [BR:cmo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     103499616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 103499616
NCBI-ProteinID: XP_008460870
UniProt: A0A1S3CDE8
Position
Un
AA seq 220 aa AA seqDB search
MAVDEESPLKLYSFWASTCAQRVRIALNLKGLNFQYKAVDLLKGEHLAPEYLKLNPVGFV
PTLVDGDVVIADSFAIIMYLEEKYPQRPLLPTDLVKRAINHQVANIVSSSIQPLQNLIVE
KYLEEKCGTEEKLSWIHMIIGKGFLALEKLLTVEAGKFATGDQIYLADLFLAPQLHRAIE
TFNVDMSKFPILSRLYEEYKKIAAFEDAAPENQPDAPSQN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggacgaagaatctccgttgaagctctactcattctgggccagcacttgtgcc
caacgtgttcgaattgccctcaacctaaaagggctaaactttcagtacaaagctgttgat
ttattgaagggagagcatttggctcctgagtatctaaagctcaatcctgttggttttgta
cctactcttgtggatggggatgttgttattgctgactcttttgctataataatgtatttg
gaggaaaagtatcctcagcgtcctttgctgcctactgatcttgttaaaagggctattaat
caccaggttgcaaatattgtttcttcaagcatacaacctcttcaaaatttaattgttgag
aaataccttgaggaaaaatgtggtactgaggagaaactttcttggattcacatgatcatt
ggaaaaggttttttagcactagaaaagttgctgacagttgaagctggaaaatttgctact
ggagaccaaatttatctggcagacttgtttttggcacctcaacttcatcgggccattgaa
acattcaatgttgatatgtccaagtttccaattctatcaaggttgtacgaagaatacaag
aagatagcagcatttgaagatgcagcaccagaaaaccaacccgatgctccctctcaaaac
tga

DBGET integrated database retrieval system