KEGG   Cucumis melo (muskmelon): 103500583Help
Entry
103500583         CDS       T03195                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
cmo  Cucumis melo (muskmelon)
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cmo04131]
    103500583
Membrane trafficking [BR:cmo04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    103500583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin WD40 zf-RING_2 zf-RING_5 zf-RING_11
Motif
Other DBs
NCBI-GeneID: 103500583
NCBI-ProteinID: XP_008462162
UniProt: A0A1S3CGC3
Position
Un
AA seq 960 aa AA seqDB search
MAPILSVNGVEGDDEREEEEEDDEDDDEEEEMADDEEEPRLKYQRMGGSVPSLLASDAAS
CLAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAVVNDLSFDTEGEYVGSCSDDGSVV
INSLFTDERMRFEYHRPMKAIALDPDYAKKTSRRFAAGGLAGHLYFNSKKWLGYKDQVLH
SGEGPIHAVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPQLVWQDDT
LLVIGWGTSVKIASIRTNHNRAANGTQSSRHVPTSSMNRVDIVASFQTSYLITGMAPFGD
VLVVLAYIPGEEGEKDFSITAPSRQGNAQRPEVRVVTWNNDELSTDARPVHGFEHYKAKD
YSLAHAPFAGSSYAGGQWAAGVEPLYYIVSPKDIVIAKPRDAEDHIAWLLEHGWHEKALE
AVEAGQGRSELLDEVGSKYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQL
PVLVPYIPTENPRLRDTAYEVALVALASNSLFHKDLLTTVKTWPPVIYSAVPVISAIEPQ
FNTSSMTDALKEALAELYVVDGQYEKAFLLYADLLKPDIFDFIEKYNLHEAIREKVVQLM
MLDCKRAVQLFIQNKELIPPNEVVSQLFKAGDKCDFRYFLHLYLHSLFEVNPHAGKDFHD
IQVELYADYDTKMLLPFLRSSQHYTLEKAYDICIKKNLLREQVFILGRMGNAKQALAVII
DKLGDIEEAVEFVSMQHDDDLWEELIKLCLHKAEMVGMLLEHTVGNLDPLYIVNMVPNGL
EIPRLRDRLVKIITDYRTETSLRHGCNDILKADTVNLLVKYYKEARHGIYLSNEEDEARG
KRNENKVSQSIQKSLNVRMMEVKSKTRGGTRCCICFNPFSIQNISVIVFFCCHAYHETCL
IESTSNLDAKKGTGETGHDLASDFDYDNGEMEDDEDGEDDTDMGGPRMRCILCTTAASKT
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atggctcccattctatcggtaaacggcgtcgaaggagacgacgagagggaggaggaggag
gaggacgatgaggacgatgatgaagaagaagaaatggctgacgacgaggaggagcccagg
ctcaagtatcagagaatgggaggaagcgtaccatcattgctggctagtgatgccgcctcc
tgccttgccgttgccgagcggatgatcgctcttgggactcacgccggcaccgttcatatt
ctcgactttctcgggaatcaggttaaggagttccctgctcatactgccgtagtcaacgat
ctcagctttgatacagaaggtgaatatgtgggtagttgttcggatgatggttcggttgta
ataaatagtcttttcactgacgagagaatgaggtttgagtatcatcgcccgatgaaggca
attgcattggacccagactatgcaaaaaaaacttcaagaagatttgcagcaggtggtcta
gctggccatttatattttaattccaagaaatggctaggatacaaagaccaggtcttgcat
tctggtgaaggcccaatacatgcagtgaaatggagaacgagccttattgcttgggcaaat
gatgcaggcgtaaaggtttatgatgctgcaaacgatcagcgaattacatttattgaaaga
ccgagaggaagcccacgtcctgaacttttgctccctcagttagtttggcaggatgatact
ctgttggtcattggctggggtacatctgtcaagattgcatcaattagaacgaaccataat
agagcagccaatgggacacaaagtagtaggcatgttccgacatctagcatgaaccgggtt
gatatagtggcatcttttcaaaccagctacttaatcacgggaatggctccatttggagac
gtcctggttgttttggcttatattcctggggaagaaggtgaaaaagattttagtataact
gctccatcccggcagggaaatgcccagagaccagaagttcgcgttgtaacatggaacaat
gatgaattatctaccgatgcccgaccggtacatggttttgagcattacaaggcaaaggac
tattcccttgcacatgctccctttgcaggcagcagctatgctggtggtcagtgggctgcg
ggtgttgaacctctgtactatattgtatccccaaaagacatagttattgcaaagcccagg
gatgctgaagatcatattgcttggcttcttgaacacggttggcacgaaaaagctttggaa
gcagttgaagcaggtcaaggaagaagtgaactacttgacgaggtaggatccaaatatctt
gatcacttgattgtggagagaaaatatgcggaagctgcctcgctgtgtcccaaattgttg
cggggctcagcttctgcttgggagagatgggttttccactttgctcatttgcgtcaactt
cccgtattagttccatacataccaacagaaaaccctagattgcgtgatactgcttatgag
gttgctctcgttgctcttgcttcaaactcattgtttcataaggatttattaacgactgtt
aagacttggccacctgtaatttattctgccgtacctgttatctcagccatagaacctcag
ttcaatacttcttcaatgactgatgctcttaaagaagcattagctgagctatatgtcgta
gatgggcagtatgagaaagcttttttgctttatgctgatctgctgaaaccagacatattt
gactttattgagaaatacaatctgcatgaggccattcgtgagaaggttgtccaactcatg
atgctagattgcaagcgtgctgttcaattgtttatccaaaataaggaacttattcctcca
aacgaagttgtttcacagcttttcaaagctggcgataagtgtgatttcagatatttcttg
cacctatatctgcattccttatttgaagtaaatccacatgctggaaaggatttccatgac
attcaggtggagctttatgctgactacgatacaaagatgctgctgccttttcttcgtagt
agtcaacattatacacttgagaaggcatatgatatttgcattaaaaaaaatcttttgagg
gagcaagtctttattcttggaagaatgggaaacgcaaaacaagcccttgctgtcatcatt
gataaattaggagatatagaagaggcagtagagtttgttagcatgcaacatgatgatgat
ctctgggaagaactaataaagctatgtcttcataaggctgaaatggttggcatgttattg
gagcacacagttggcaatctagatcctctttatattgtcaacatggttcctaatggttta
gagatacctcgcctccgggatcggctagttaaaatcattactgattacaggacggaaacc
agtcttagacatggatgcaatgatattttaaaggccgacactgtgaatctattggttaag
tactacaaagaggccagacatggaatttacttgagcaatgaggaagatgaagcacgtggg
aagaggaacgaaaataaggtttctcaatcaattcaaaaatctttgaatgttagaatgatg
gaggtgaagtcgaaaactcggggaggcactcgatgctgcatatgttttaatccattttca
atacaaaacatttcagtcatcgtgttcttttgctgccatgcgtatcacgagacttgtctc
atagaatcaacctccaatcttgatgctaagaaagggactggagaaactggccatgacttg
gcatctgactttgattatgacaacggagaaatggaggacgacgaagacggtgaggatgat
acagatatgggcggtcctagaatgcgttgtattttatgtactactgctgcttccaagact
tga

DBGET integrated database retrieval system