KEGG   Cucumis melo (muskmelon): 103500806Help
Entry
103500806         CDS       T03195                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00052  Galactose metabolism
cmo00500  Starch and sucrose metabolism
cmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103500806
   00500 Starch and sucrose metabolism
    103500806
Enzymes [BR:cmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103500806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 103500806
NCBI-ProteinID: XP_008462456
UniProt: A0A1S3CH10
Position
Un
AA seq 404 aa AA seqDB search
MAPTPQNHINASSFRDPTTAWLGRDGEWRVIIGSKVHTRGLALMYQSKDFVKWKQVDHPL
HYAEGTGMWECPDFFPVAKTGRSGVDTTMSGKNTKHVLKISLDDTKHDVYTIGTYDLEKD
VYVPNKGSIEGYNALRYDYGKYYASKTFYDGQKKRRVLWGWVNESSSVEDDIKKGWSGIQ
AIPRTVWLDASGKQLIQWPIEEIQKLRKNKVTLTNKVLKKGSTIEVKGVTPSQADVEVSF
KVKNFKKAQILKPQYWENPQLLCSQKGTATTKGGVGPFGLLVLASNDFKEYTSVSFTIFK
KQGKYVVLMCSDQSRSSLNPTNDKTTYGAFLDVDLISEYLSLRSLIDHSVVESFGSKGKA
CITARVYPTLAIGDNVGLYAFNNGTDSVNITKLTAWSMKKAVIS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaccccacaaaaccacatcaatgccagctccttccgggaccccaccaccgcc
tggctcggtcgcgacggtgagtggcgagtcatcattggaagcaaagttcacactcgtgga
ctcgccctcatgtaccaaagtaaagatttcgttaagtggaagcaggttgaccatccactt
cattatgcggaggggacgggaatgtgggaatgtccagatttcttcccggtagcaaagacc
ggtcgaagcggggttgacacgaccatgagtggaaagaacacgaagcatgtattgaaaatc
agcttggatgatacgaagcacgacgtttatacgataggaacatatgatttggagaaagat
gtttatgtaccaaacaaaggatcaatagaaggttacaatgcattgagatatgattatggg
aaatattatgcttcaaaaactttctatgacggacaaaagaagaggagagttttgtggggt
tgggtgaatgaatcatcaagtgttgaagatgatatcaagaaaggatggtctggcatccag
gcaattccaaggacagtttggttggatgcttctgggaagcaactaattcaatggccaatt
gaggagattcaaaagcttagaaagaacaaagttacattgacaaacaaagtattgaagaaa
ggatcaacgattgaagtaaaaggtgttaccccatcgcaggcagatgttgaggtttcattt
aaagtgaaaaacttcaagaaagctcaaatattgaaacctcaatattgggaaaacccacaa
ttgctttgtagtcaaaagggaacagcaactacaaaaggtggagttggtccttttggactt
ctagttttggcttcaaatgacttcaaagagtacacttctgtctcctttaccatattcaaa
aaacaaggcaaatacgttgtcctcatgtgtagcgaccaaagcagatcttcgttaaacccg
actaatgacaagacaacatatggagcgttcttagatgtggacctcattagcgaatatctt
tcattaagaagtttgattgatcactcagttgttgagagctttggatctaaggggaaagct
tgcataacagcaagagtttatccaacattagccattggagacaatgttggtctctatgct
ttcaacaatggaacagacagtgtcaacattacaaaactcactgcttggagcatgaagaaa
gctgttatcagttaa

DBGET integrated database retrieval system