KEGG   Cucumis melo (muskmelon): 103500807Help
Entry
103500807         CDS       T03195                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00052  Galactose metabolism
cmo00500  Starch and sucrose metabolism
cmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103500807
   00500 Starch and sucrose metabolism
    103500807
Enzymes [BR:cmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103500807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C PhnA
Motif
Other DBs
NCBI-GeneID: 103500807
NCBI-ProteinID: XP_008462457
UniProt: A0A1S3CH19
Position
Un
AA seq 407 aa AA seqDB search
NPLMAPTPQNHINASSFRDPTTAWIGPDGEWRVIVGSKLDARGLAVMYRSKDFVKWNQVD
HPLHYKDGMGMWECPDFFPVAKTGRKGVETRVYGSQVKHVLKVSLDDTKHDVYTVGTYNW
QKDIYIPNKGSIESYNGLRYDYGKYYASKTFFDSQKKRRVLWGWVNESSSVDDDIKKGWS
GVQAIPRAVWLDASGKQLIQWPVVEIQKLRNNKVKLTNEVLKKGSIVEAKGVTAAQADVE
ISFKVENFKKAEILKPEWKDPQLLCSQKGTSTTKSGSVGPFGLLVLASNDLKEYTSVSFR
VFKGQHKYVVLMCSDQSRSSLNSNNDKTTYGAFLDVDPTRENLSLRSLIDHSIVESFGIK
GKGCITARVYPTLAIGDSVGLYAFNNGTDSVTITKLTAWSMKKALIN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
aatcctctcatggcccccaccccacaaaaccacatcaatgccagctccttccgggacccc
accactgcctggatcggtcccgacggggagtggcgagtcatcgtcgggagcaaacttgac
gcccgtggactcgctgtcatgtatcgaagtaaagatttcgtcaagtggaatcaggttgac
caccccctacattacaaggatggcatgggaatgtgggagtgtccagatttcttcccggtg
gcaaaaaccggtcgaaaaggtgtcgagacgagagtgtatggatcgcaggtgaagcatgtg
ctgaaggtgagcttggatgataccaagcacgacgtttatacggttggaacatataattgg
caaaaagacatttacattccaaataaaggatcaattgaaagttacaatggattaagatat
gattatggaaagtattatgcttcaaaaacattctttgacagccagaagaagagaagggtt
ttgtggggttgggtcaatgaatcttcaagtgttgatgatgatatcaagaagggttggtcc
ggtgtccaggcaattccaagggctgtttggctagatgcatctggaaaacaactcattcaa
tggccagttgtagaaattcaaaagcttcgaaacaacaaagttaaattgacaaatgaagtt
ttgaagaaaggatcaattgttgaagccaaaggtgtaacagcggcacaggcagatgtggag
atttcattcaaagtggaaaattttaagaaagctgaaatattgaaacctgaatggaaagac
ccacagttgctttgtagccaaaagggaacatcaactacaaaaagtggatcagttggtcca
tttgggcttttagttttggcttcaaatgacctcaaagagtacacttctgtctcctttaga
gtattcaaaggacaacacaaatatgttgtactcatgtgcagtgaccaaagcaggtcttct
cttaattccaataatgacaagacgacatacggagcatttttagacgttgatccaactcgt
gaaaatctttcactaagaagcttgattgatcactcaatagtagaaagctttggaattaaa
gggaagggttgcataacagcaagagtttatccaacattagccattggagacagcgttggt
ctctatgctttcaacaatggaacagacagtgtcaccattacaaaactcactgcctggagc
atgaagaaagctcttatcaattga

DBGET integrated database retrieval system