KEGG   Cucumis melo (muskmelon): 103501021Help
Entry
103501021         CDS       T03195                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK9
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
cmo  Cucumis melo (muskmelon)
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmo01001]
    103501021
   01009 Protein phosphatases and associated proteins [BR:cmo01009]
    103501021
Enzymes [BR:cmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103501021
Protein kinases [BR:cmo01001]
 Serine/threonine kinases: Other
  Wnk family
   103501021
Protein phosphatases and associated proteins [BR:cmo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103501021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 103501021
NCBI-ProteinID: XP_008462723
UniProt: A0A1S3CI45
Position
Un
AA seq 615 aa AA seqDB search
MDTTDSITAFSHLLQPPDFSHYVEIDPTGRYGRYNEILGKGASKTVYRAFDEYEGIEVAW
NQVKLCNFLQCPEDLERLYSEIHLLKTLKHKNIMKFYTSWVDTANKNINFVTEMFTSGTL
RQYRLKHRRANIRAVKRWCRQILRGLHYLHSQDPPVIHRDLKCDNIFVNGNQGEIKIGDL
GLAAILQKSHADHCVGTPEFMAPEVYEEAYNELVDIYSFGMCVLEMVTFEYPYSECNHPV
QIYKKVISGKKPDALYKVKDPSMRQFVEKCLAPVSCRLSARELLSDPFLEIDICESKLKI
SDSRRELDDFASTIVRPFLEREKRFSSISYSLEASDEWRYRSVQKERDGIELFEDNDNDQ
LENLDKNIKGKIREDGSIVLRLRITDKEGLIRNIYFPFDTKNDTALTVATEMIAELDITD
QDVIKIAEKIDGEISSLVPEWKPGPGIDETPRISYDGGSQSYNASNQPSDNILIENKGNG
IKLYQILNLSTDGHALAHKHFEQEQFSLKADRPTQPVVGSIPNVSSQHYQPDSVLPENQA
LSSRSFRQRHYDDNYKKTDQSLAVGYKEKLPDKKATVIDTSQRSLLGSRSLSRVSSYCED
KFSSQIHWEIRWLWN
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaccgattcaatcactgctttctctcatcttcttcaacctccagatttctct
cactatgttgaaattgatcccactggcagatatggaagatataatgaaatcctcggcaaa
ggagcttccaagacagtttacagagcatttgatgagtatgaagggattgaagttgcttgg
aatcaggtcaaactctgtaacttccttcaatgtcctgaagatcttgagaggctatactct
gagattcatctcttaaaaacattgaaacataaaaacataatgaaattctatacctcttgg
gtcgatactgcaaataagaacatcaactttgtaactgaaatgttcacttctgggactctg
aggcagtataggctaaagcataggagagctaacattagggcagtgaagcgatggtgtaga
caaattttgaggggtcttcattatctccatagccaagacccccctgtgatccacagagat
ctcaagtgtgacaacatttttgttaatggtaaccagggagaaattaaaattggagacctt
ggtcttgctgctatcctccagaaatcacatgctgatcattgtgttgggacaccagagttc
atggctcctgaagtatatgaggaggcatataatgaattggtagacatttattcttttggg
atgtgtgttttggagatggttacgtttgaatatccatatagtgaatgtaatcatcctgtt
caaatctataagaaagtaatttctgggaaaaaaccagatgccttgtataaagtgaaggat
ccaagcatgcgacaattcgttgagaaatgcttggcaccagtctcttgtagactttcagca
agggagcttttgagtgacccttttcttgaaattgatatttgtgaaagcaagttgaaaatt
tcagattctcggagagaactggacgattttgcttccactatagtgcggccttttcttgaa
cgagaaaaaagatttagctcaattagttacagtttggaggcctcagatgaatggaggtac
cgttcagtccagaaggaacgtgatgggattgaactttttgaggacaatgataatgaccaa
ttggaaaatcttgataaaaatattaaggggaaaatacgtgaagatggcagcattgtttta
agacttaggattacggataaagaagggcttattcggaacatatatttcccatttgacacc
aagaatgatacagcattaacagtagccaccgaaatgattgcagaacttgatattactgac
caagatgtgatcaagatagctgaaaaaattgatggggaaatttcttccttggtacccgag
tggaagccagggcctggcatagacgaaacacctcgcatctcttacgatggtggctctcaa
agctacaacgcttctaatcaaccatctgataatattttgatagagaataaaggaaatgga
atcaaactttatcagattttgaacttaagcacagatgggcatgctttggcacataaacat
ttcgagcaagagcagttctcgctcaaagcagatcggcctacacaacctgtggtagggagc
ataccaaatgtgtcaagccagcactatcagccagattctgtcctccctgaaaaccaagct
cttagttctcgtagttttaggcaaagacattatgatgataattacaagaaaactgaccaa
tcactcgctgttgggtataaagaaaaactaccagataagaaagccactgtcattgacact
tcacaaagaagcttattgggttcccgatcactgtccagggtttcatcctattgcgaagat
aaattttcctctcaaatccattgggaaattagatggctgtggaattga

DBGET integrated database retrieval system