KEGG   Cucumis melo (muskmelon): 103502274Help
Entry
103502274         CDS       T03195                                 

Definition
(RefSeq) magnesium protoporphyrin IX methyltransferase, chloroplastic
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00860  Porphyrin and chlorophyll metabolism
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    103502274
Enzymes [BR:cmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     103502274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_12 Methyltransf_31 Methyltransf_23 Methyltransf_11 PrmA MTS Ubie_methyltran CMAS CheR TehB Methyltransf_32 Methyltransf_18 tRNA_U5-meth_tr UPF0020 DREV NodS Methyltransf_9 Methyltransf_4
Motif
Other DBs
NCBI-GeneID: 103502274
NCBI-ProteinID: XP_008464364
UniProt: A0A1S3CMU6
Position
Un
AA seq 316 aa AA seqDB search
MSHSASRYLTLCFHPDSTSNSRFFLSPTPIKLIKFSRTLNLNVSAVATELPIVDGATIAA
IGGGSVAALAAVLSLTDPERRRRLQAEEVGGGDKDVVKEYFNNSGFQRWKKIYGETDDVN
RVQRDIRLGHSKTVENVMAMLKDEGPLRGVTVCDAGCGTGSLSIPLAKEGAKVFASDISA
AMVAEAENKAKEEVKGGVMPKFEVKDLESLEGKYDTVVCLDVLIHYPQNKADGMIAHLAS
LAEKRLIISFAPKTFYYDLLKRVGELFPGPSKATRAYLHSEADVETALRRVGWKIRKRGL
ISTQFYFATLVEAVPA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtctcactctgcatctcgatatctcacactttgcttccaccccgattctacctcaaat
tctagattcttcttatctccaacacctatcaagctcattaaattttcaagaacgctcaat
cttaatgtctctgctgtagccactgaacttcccatcgtcgacggagcaacaattgcagcc
atcggcggcggttcggttgccgcgctggctgccgttctatctctgaccgatccggagaga
cgccgccgcctgcaggccgaagaggtgggtggtggcgacaaggatgtggtgaaggaatac
tttaacaattcggggtttcagaggtggaagaaaatctatggagagacggatgatgtgaac
cgggtgcagcgagacattaggttgggtcactccaagacggtggagaatgtgatggcgatg
ttgaaagatgagggcccactgagaggagtaacagtgtgcgatgccggctgtggaaccggt
agcttatctattcccctagccaaggaaggtgcgaaagtcttcgctagcgatatttctgct
gctatggtcgcggaggccgaaaacaaggcaaaagaagaggttaagggaggcgtgatgcca
aaatttgaagtgaaagatttggagagcttggaagggaaatacgatacggtggtatgtcta
gatgttttaatacactacccccagaacaaggcagacggaatgattgcgcaccttgcatcc
ctagctgaaaagcgtttaatcataagctttgcgccaaaaacattttactacgatttgttg
aagagggtgggagagttgttccccggaccttcaaaggcaactagggcatatttgcactct
gaggctgacgtcgaaactgcattgcggagggttggctggaaaataaggaagagaggtcta
atctctacacagttttactttgccacattggttgaggcagttcctgcttga

DBGET integrated database retrieval system