KEGG   Cucumis melo (muskmelon): 103502385Help
Entry
103502385         CDS       T03195                                 

Definition
(RefSeq) tryptophan aminotransferase-related protein 2-like
  KO
K16903  L-tryptophan---pyruvate aminotransferase [EC:2.6.1.99]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00380  Tryptophan metabolism
cmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    103502385
Enzymes [BR:cmo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.99  L-tryptophan---pyruvate aminotransferase
     103502385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alliinase_C Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 103502385
NCBI-ProteinID: XP_008464530
UniProt: A0A1S3CLP2
Position
Un
AA seq 442 aa AA seqDB search
MGVVSLRNFFVLSLALNVSLILKAVNQKENLHSGASIAVEKGAKVAKMTFLSLPSLSSPS
AAAPETQTPLATERVINLDHGDPTMYEQYWKPMGDKTTIVIPGWQSMSYFSDVTNLCWFM
EPELAKQIVRIHKVVGNAVTKGRHIVVGTGSSQLLLAALYALSPLDSSNPISVVSAAPYY
SSYPLMTDCVKSGLHKWSGDAKVFDKDEPYIELVTSPNNPDGFVRHGVVNRTGGILVHDL
AYYWPQYTPISTPADNDLSLFTVSKCTGHAGLRIGWALVKDVEVAKRMIKFIELNTIGVS
KDSQLRAAKVLEVVSNSCEQAGGSEYAESFFLFSHTLMAERWRLLREAVKRSGIFNLPNF
SPAHCNFFDNTLGTQPAFAWLKCDRDDIDDCENFLRGHKILTRSGKHFGVGSKYVRISML
DREETYNLFIERLSQISSYSYI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtggtttcactgaggaatttcttcgtactgtctctagctttgaatgtgagtttg
attttaaaagctgtaaatcagaaagagaacctccatagtggagcttcaatagcggtcgag
aaaggggctaaagttgccaaaatgacatttttgtctttaccttctctgtcatctccatca
gcggctgctcctgaaactcaaactcctcttgctaccgaaagagtcattaatcttgaccat
ggtgacccaacaatgtatgagcaatattggaagccaatgggggacaagactacaatagtg
atccctggatggcaatcaatgagctatttttctgatgttacaaacctttgttggttcatg
gagcctgaattggccaagcaaattgtcaggatacataaggtggtcggtaacgccgttacc
aaagggcggcacattgttgttgggacgggatcatctcaacttctcttagctgcgctctat
gccttgtccccactagattcgtcgaacccgatcagcgtggtttctgcagccccatactac
tcgtcttaccctttgatgaccgactgcgttaagtcggggctccacaaatggtctggcgat
gcaaaggtatttgacaaggacgagccttacattgaattggtcacctctcccaacaatcct
gatggcttcgttcgacatggcgtggtgaaccgaactggtggtatattggtccatgacctt
gcttattattggccacaatataccccaatatccaccccggctgacaatgacttgtcgttg
ttcaccgtgtcaaaatgtactggccatgctgggttgcgcattgggtgggctcttgtgaag
gatgttgaagttgcaaagagaatgatcaaattcatagagctgaacaccattggtgtgtct
aaagactcacagcttcgggctgccaaagttcttgaagtagtatccaacagttgtgaacag
gccggtggttcggagtatgcggaatccttcttccttttcagccacaccctcatggccgag
cggtggaggctgctaagggaggcagtgaaacgtagtggcatatttaatttacctaatttt
tctcctgcacattgcaacttcttcgacaacacattgggaactcaacctgctttcgcatgg
ttaaaatgcgatcgtgacgacattgatgattgtgaaaacttcctccgaggccataagatc
ctcacacgaagtggaaaacattttggtgttggctcgaaatacgttcgaattagtatgctt
gaccgtgaagaaacgtacaatttatttatagaaagattgtctcagatcagctcatactcg
tacatctga

DBGET integrated database retrieval system