KEGG   Cucumis melo (muskmelon): 103504616Help
Entry
103504616         CDS       T03195                                 

Gene name
INV2
Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00052  Galactose metabolism
cmo00500  Starch and sucrose metabolism
cmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103504616 (INV2)
   00500 Starch and sucrose metabolism
    103504616 (INV2)
Enzymes [BR:cmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103504616 (INV2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 103504616
NCBI-ProteinID: NP_001284469
UniProt: B6V3B8
Position
Un
AA seq 630 aa AA seqDB search
MDSTSSDLIPPPYSALPDRHPSPALPRKSRNFTTTTILISFLLLVSLFALFSYTNTSSPE
SVKLPENTQSRLARGVAEGVSAKSNPYFSDSVDGSFNWTNAMFSWQRTAFHFQPEGNWMN
DPNGPLYHRGWYHLFYQYNPESAVWGNISWGHAVSRDLIHWLYLPYAMVPDQSYDVNGVW
TGSATILPDGRIIMLYTGDTIDGVQVQNLAYPANLTDPLLLNWVKYPGNPVLVPPPGIGL
KDFRDPTTAWLGPDGKWRITIGSRVGTTLGVSLVYTTNDFIKYELVDRFLHAVPGTGMWE
CVDFYPVSVDGSKGLDTSENGGGVKHVLKASLDDTKMDHYAIGTYFANNDTWVPDNPEED
VGIGLKYDYGRYYASKTFYDQNKERRILWGWINETDTEANDLAKGWASVQTVPKTVLFDQ
KTGSNIIQWPVEEVESLRLGSNEFNDVLLVPGSVVELEVGPATQLDILAEFEVEVLGSEN
GAVSEEGCGGGAAERSSLGPFGVLVLAHQSLSEFTPIYFNVANSSKGSGEAYFCADETRS
SKAPDVFKQVYGSKIPVLEGENYSMRVLVDHSIVESFGQGGRRVITSRIYPTEAIYGAAK
LFLFNNGTSANVKAAVKVWQLNSAFIQPYF
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggattctacttcttcagatctcatccctccgccttactccgccttgccggaccgccat
ccctccccggcgcttccccgaaaatcccgcaacttcactacaactaccattctcatctct
tttctccttctcgtttctttatttgctctgttttcttacactaacacctcatctcccgaa
tccgtcaagttgccggaaaacacccaatcgcgactagcgagaggagtcgctgagggcgtt
tccgccaaatcgaacccttatttttccgattctgttgatggttctttcaattggaccaac
gctatgttctcttggcaacgaactgccttccattttcaacctgaaggcaattggatgaac
gatcccaatgggccattatatcacaggggttggtatcatctattttaccaatataaccct
gaatccgctgtatggggcaacataagttggggccacgccgtttcaagagatctcatccat
tggctctatctcccttacgccatggtcccagatcaatcgtacgatgtcaacggcgtttgg
accgggtccgccacaatccttccggacggtcggatcataatgctctacactggcgatacc
attgatggagtgcaggtccaaaatctagcataccctgccaacctaaccgatcccctcctc
ttaaattgggttaagtacccgggcaacccggtcttggttcccccacccggcattggcctc
aaagacttccgcgaccccactacggcctggctcggccccgacggtaagtggcggatcacc
attgggtcacgcgtggggacaacattgggggtttcgttggtttatactactaatgatttt
attaagtacgagcttgtggaccgattcttgcacgcggtcccgggtacgggcatgtgggaa
tgcgttgatttttatccggtatcggttgacgggtcgaagggtttggatacgtcggagaat
ggtggtggtgtaaagcacgtgctcaaggcgagtttggatgatactaaaatggatcattat
gcaattgggacttattttgctaataatgatacttgggttcccgataacccggaagaagat
gtgggaattggcttgaaatatgattatggaagatactatgcttccaagacattttacgac
caaaataaagagaggaggatcttgtggggttggatcaatgaaactgacactgaagctaat
gatttggcaaaaggctgggcctccgttcagacggttccgaagacagtgctattcgatcag
aagacaggcagcaacataatccaatggcctgtggaagaggtggaaagtttgagactgggg
agcaatgaatttaatgacgtgctcctcgtacctggctctgtcgtggaactcgaagtcggc
cctgctacacagttggatatattggcggagtttgaagtggaagtgctcgggtcagagaat
ggtgccgtctccgaggaaggctgtggtgggggtgcggcggagagaagtagtttaggacca
tttggtgtgttggttttggctcatcaatcgctttccgagtttactcctatttacttcaat
gttgctaattcaagtaaaggcagtggggaagcttacttttgtgccgacgagacaaggtca
tcaaaagctcctgatgttttcaaacaagtttatggaagcaaaattcctgttttagagggt
gaaaattactccatgagagtgttggtggatcactcaattgtggagagttttggacaaggt
gggagaagagtgataacatcacgaatttatccaacagaagcaatttatggtgcagccaag
ctttttcttttcaacaatggcacatcagcaaatgtaaaggccgctgtcaaagtatggcag
ctcaattctgccttcattcaaccatatttttga

DBGET integrated database retrieval system