KEGG   Cucurbita moschata (crookneck pumpkin): 111430090Help
Entry
111430090         CDS       T05248                                 

Definition
(RefSeq) magnesium protoporphyrin IX methyltransferase, chloroplastic
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00860  Porphyrin and chlorophyll metabolism
cmos01100  Metabolic pathways
cmos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    111430090
Enzymes [BR:cmos01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     111430090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_12 Methyltransf_31 Methyltransf_23 Methyltransf_11 MTS PrmA CMAS Ubie_methyltran Methyltransf_18 TehB Methyltransf_32 DREV UPF0020 tRNA_U5-meth_tr
Motif
Other DBs
NCBI-GeneID: 111430090
NCBI-ProteinID: XP_022922008
Position
Unknown
AA seq 323 aa AA seqDB search
MAHSAFPYPTLCFHPDSTTNPRFFLSPPPLKLVKFSRTPNVNAPAPAPPLSAVATELPVV
DGATIAAIGGGSVAALAAVLSLTDPERRRRLQAEEVGGGDKDVVKEYFNNSGFQRWKKIY
GETDDVNRVQRDIRLGHSKTVENVMGMLKDEGPLTGVTVCDAGCGTGSLSIPLAKEGAIV
FASDISAAMVAEAQNKAKEEVAGGVVPKFEVKDLESLEGKYDTVVCLDVLIHYPQNKADG
MIAHLASLAEKRLIISFAPKTFYYDLLKRVGELFPGPSKATRAYLHSEADVETALRRVGW
KIRKRGLVSTQFYFATLVEAVPA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctcactccgcatttccatatcccacactctgcttccaccccgactctaccacaaat
cctcgattcttcctgtctccaccccctctcaagcttgttaaattttcaagaacgcccaat
gttaatgcgcctgcgcctgccccaccactctccgccgtagctaccgaactccccgtcgtc
gacggggcaacaattgcagcgatcggcggcggttcggttgccgcgctcgctgccgttcta
tctctcaccgacccggagagacgtcgccgcctgcaggccgaagaggtgggtggtggcgac
aaggatgtggtgaaggaatacttcaacaattcggggtttcagaggtggaagaaaatatat
ggagagactgatgatgtgaaccgggtgcagcgagacattaggttgggtcactccaagacg
gtggagaatgtgatgggcatgttgaaagatgagggcccactcacaggagtaacagtctgc
gatgccggctgtggaaccggtagcttatccattccgctggccaaggaaggtgccatcgtc
ttcgccagtgatatttctgctgctatggtcgccgaggcccaaaacaaggcaaaagaagag
gttgcgggaggcgtggtgccaaaatttgaagtgaaggatttggagagcttggaagggaag
tatgatacggtagtatgtctggatgttttgatacactatccccagaacaaggcagacggc
atgattgcgcaccttgcatccttagctgaaaagcgtttgatcataagctttgcgcccaaa
acattttactatgatctgctgaagagggtgggagagttgttccccggaccttccaaggca
accagggcatatctgcactcggaggcagacgtggagaccgcgttgcggagggttggctgg
aaaattaggaagagaggtctagtctccacccagttttactttgccacactggttgaggca
gttcctgcttga

DBGET integrated database retrieval system