KEGG   Cucurbita moschata (crookneck pumpkin): 111430624Help
Entry
111430624         CDS       T05248                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C-like
  KO
K03252  translation initiation factor 3 subunit C
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111430624
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cmos03012]
    111430624
Translation factors [BR:cmos03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    111430624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI DUF3175
Motif
Other DBs
NCBI-GeneID: 111430624
NCBI-ProteinID: XP_022922710
Position
Unknown
AA seq 938 aa AA seqDB search
MASRFWTQGGGSGSDSEAEESDYDEENDDIQVDLGSQQNRSRYLQGNASDSEDSEDKKRT
VRSAKDKRFEEMSATVDQMKNAMKINDWVSLQENFDKINKQLEKVMRVTESEKVPTLYIK
ALVMLEDFLNQAMANKEAKKKMSTSNAKALNSMKQKLKKNNKQYEEVITKYRENPEVEEE
EKDEELETEEEEDSDSEIEDPSKIMSGTEDEEDEEEGPDDDPTGPWQKKLSKKDKLMDKQ
FMKDPSEITWDTVNKKFKEVVAARGRKGTGRFEQVEQLTFLTKVAKTPAQKLEILFSVIS
AQFDVNPGLSGHMPISVWKKCVQNMLSIVDILVQNSNIVVDDMVEPDENESQKPADYKGT
IRVWGNLVAFVEKIETEFFKSLQCIDPHTREYVERLRDEPMFMVLAQNVQEYLERVGDYK
AASKVALRRVEQIYYKPQEVYDAMRKLAELSEDGDSGDASEEAKVVEESRGPAAFVVTPE
VVPRKPTFPESSRAFMDILVTLIYQYGDERTKARAMLCDIYQHALLDEFYISRDLLLMSH
LQDSIQHLDISTQILFNRAMAQLGLCGFRVGLINEGHGCLSELYSGGRVKELLAQGVSQS
RYHEKTPEQERLERRRQMPYHMHINLELLEAVHLICAMLLEVPNMAGNVHDAKRKVISKN
FRRLLEVSERQTFTGPPENVRDHVMAATRALRKGDFQKAFDVIASLDVWKLLRNREEVLE
MVKGKIKEEALRTYLLTYSSSYDSLSSEQLTRMFDLAEGQTHSIVSKMMINEELHASWDQ
PSGCVIFHDVTHTRLQGLAFQLADKLSILAETNERAVEARIGGGLDLPMRRRDNQEYAAG
GAAGGNNRWPDNMSYNQGRQGGISSRAGYGGRGQGGGGGYSRDRTGQSRGGNAGYQSTRY
QDAAAYGSGRTAYQSGSVRGSQMDTSARMVSLNKGVHA
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcgtttctggacacagggtggtggcagtggttctgactctgaagcggaggag
agtgactatgatgaagagaatgacgatattcaggttgatcttgggtctcagcagaacaga
agcagatatctgcaagggaatgccagtgacagtgaagattctgaggacaagaagcgtact
gtcaggtcggctaaagataagcgttttgaggagatgtctgccactgtcgatcaaatgaaa
aatgcaatgaagatcaatgactgggtaagcctgcaggagaattttgataagatcaataag
cagcttgagaaagtcatgcgtgttactgagtctgagaaggtgccgactctttatattaaa
gcacttgtgatgctagaggactttctaaatcaagccatggccaataaggaagcgaagaaa
aaaatgagtactagcaatgctaaggccttgaactcaatgaaacagaagctaaagaagaac
aataagcaatatgaagaggtaattaccaagtatagggaaaatcctgaggttgaagaagaa
gaaaaggacgaagagttggagacagaggaggaggaagattctgattctgaaattgaggat
ccttctaaaatcatgtcaggtacagaagatgaagaggatgaggaagaaggcccagatgat
gatccaacgggtccctggcagaagaagttgagcaaaaaagataagctcatggataagcaa
tttatgaaggatcctagtgagatcacatgggacactgtgaacaagaaatttaaggaagtt
gtggctgctcggggtaggaagggaactggaagatttgagcaggttgagcagcttacattc
ttaacaaaagttgctaagacccctgcacaaaagcttgagattttgttcagtgttatatct
gctcaatttgatgttaatccaggtctcagtgggcacatgcctatcagtgtgtggaagaag
tgtgtgcaaaacatgctttccatagttgatattcttgtgcagaattctaacatcgttgtg
gatgatatggtcgaacctgatgagaatgaaagccagaagccagcagactacaagggaact
attcgtgtttggggtaacctggttgcttttgttgagaagattgaaactgagttttttaag
agtttgcagtgtattgatccacatacacgtgagtatgttgaaagactcagagatgagcca
atgttcatggttcttgctcagaatgtccaagaatatttggaacgagttggggattacaaa
gcagcttccaaagttgccctgaggcgtgttgagcagatctattacaaaccacaagaggtt
tatgatgccatgagaaagcttgcagaactgtctgaagatggagatagtggagatgcgagt
gaggaggctaaagtggtagaagagagtaggggccctgctgcatttgttgtcactccagag
gttgtacctcgtaagcccacctttccggagagtagtagggcttttatggacattctggtg
accctcatataccaatatggagatgagcgcactaaagcacgagctatgctatgcgatatt
tatcaacatgctctcttggatgaattttatatttctcgtgacttattactgatgagtcac
ttacaggatagtatccaacacttggacatttcaacacagatccttttcaacagggcaatg
gctcaacttggtttatgtggatttcgggtaggcctgattaatgaaggacatggctgcctt
tcagaattatattctggtggaagggtgaaggaattgcttgcacaaggtgtctcacaaagc
cgatatcatgaaaagactccagaacaggaaagacttgaaagaagaagacagatgccatac
cacatgcacattaatcttgagctccttgaggctgtgcatttaatatgtgcaatgctgctg
gaagtacccaacatggcaggcaatgttcatgatgcaaagcgcaaggttattagtaagaac
tttagacgcttacttgaggtgagtgagcgacaaacttttactggtcctcccgagaatgtc
agagatcatgtaatggctgcaacccgtgcccttcgtaagggcgacttccagaaggctttt
gatgtcattgcatctctagatgtatggaaactactaaggaatcgcgaagaagttcttgaa
atggttaagggaaagatcaaggaggaggctctgaggacttaccttctcacgtactcttcg
tcttatgattctctgagttcagaacaactcacccgaatgttcgacctcgcagagggtcaa
acacacagtattgtgagcaagatgatgatcaatgaggagctccatgcaagttgggatcag
ccaagtgggtgcgtcatcttccacgacgttacacacacccggttacagggcctggcattc
caattggcagataagttgtcaatccttgctgaaaccaatgagagggcagttgaggcaaga
ataggtggaggattagatttgcccatgaggcgaagagacaaccaagaatatgctgctgga
ggagcagcaggtgggaataacaggtggccagataacatgtcttataatcaaggaaggcaa
ggcggtattagttcgcgtgcaggatatggagggcgaggccaaggtgggggcggtggatat
tctagagaccggacgggtcagtcccgaggagggaacgctggataccaaagcacccgttat
caagatgctgctgcatatggatcggggaggaccgcttatcagtctgggtcggtccgagga
tcccagatggatacttcagctcggatggtcagtctgaacaaaggggttcatgcttaa

DBGET integrated database retrieval system