KEGG   Cucurbita moschata (crookneck pumpkin): 111431600Help
Entry
111431600         CDS       T05248                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00020  Citrate cycle (TCA cycle)
cmos00640  Propanoate metabolism
cmos01100  Metabolic pathways
cmos01110  Biosynthesis of secondary metabolites
cmos01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111431600
   00640 Propanoate metabolism
    111431600
Enzymes [BR:cmos01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     111431600
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     111431600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 111431600
NCBI-ProteinID: XP_022924052
Position
Unknown
AA seq 341 aa AA seqDB search
MGRQAVAKLIGSAINRKISSSSSSSVFSRAASQIRHYAAAPPPPPAVFVDKNTRVICQGI
TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP
FAAAAILEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKI
GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKF
LADPQTEGIVLIGEIGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSG
GKGTAQDKIKTLREAGVTVVESPAKIGVTMLDVFKQRGLVS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgccaagctgttgccaagcttataggatcggccattaatcgcaaaatttcttca
tcttcatcatcatctgtgttttcgcgggcggcgtcgcagattcggcattacgcagctgct
cctccgcctccgccggcagttttcgttgataagaacactcgcgtcatatgtcaagggatc
accggtaaaaacggtacctttcatacagagcaggccatcgaatatggcaccaaaatggtt
ggtggtgttacgccgaagaagggtggaacagaacacttgggccttcctgtttttaacaca
gttgctgatgctaaagctgaaacaaaggccaatgcatcagtaatttacgtccccccgcca
tttgctgcagcagcaatattggaggcgatggaagctgagctagatctcgttgtttgtata
acggaagggatcccacagcatgacatggtgcgagttaaggctgctttaaacaggcaatcc
aaaactagattgattggccctaattgccctggcattatcaagcctggagaatgtaaaatt
ggaattatgcctggatatatccacaaacctgggcgcattggcattgtgtcacgatctggt
accttgacctatgaggcggtttttcaaacaactgccgttggccttggacaatccacatgc
gtaggcattggaggggatccctttaatgggactaactttgttgattgcatcgagaagttt
cttgctgatcctcagacagaaggtattgttctaattggagaaataggtgggactgctgaa
gaagatgctgctgctttgataaaggaaagtgggactgagaagcctattgttgcattcatt
gctggcttaactgctcctccaggccgtcgcatgggtcatgccggtgccattgtttcaggt
ggaaaaggtacagcccaagacaaaatcaagactctacgagaagctggagtaacagtggtg
gagtcacctgcgaaaattggcgttacgatgctcgatgttttcaaacagagaggactcgtt
agttaa

DBGET integrated database retrieval system