KEGG   Cucurbita moschata (crookneck pumpkin): 111432015Help
Entry
111432015         CDS       T05248                                 

Definition
(RefSeq) probable LRR receptor-like serine/threonine-protein kinase At1g34110
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmos01001]
    111432015
Enzymes [BR:cmos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111432015
Protein kinases [BR:cmos01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111432015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase LRR_8 LRR_4 LRRNT_2
Motif
Other DBs
NCBI-GeneID: 111432015
NCBI-ProteinID: XP_022924575
Position
Unknown
AA seq 689 aa AA seqDB search
MSVFHSFLISIFFLVFSSPSAISESSELSILMAIKASLDPQNTLLTSWSPSSNPCGGYFE
GVACNEQGKVVNISLQGMGLSGYIPAAVAGLKSLTGLYLHFNALIGEIPKEIASLTELTD
LYLNVNQLSGEIPFEIGNMVNLQVLQLCYNKLTGGIPSQVGNMKVLNVLAVQYNQLTGAI
PASLGNLTALTRLDLSNNKFFGPIPVILADAPALEVLNVQNNSLTGNVPPGFRRLKEKFV
YDNNPSLCGVGFRDLNPCSKLKSLNPSRPEPFLPQLPTNLSARDIPESANLRHDCNGSNC
LRQSKSSRVGVALGVIGVFAAFSAIGLATFSWYRRNEHKFGSSSNGISRRMITSQVREVY
RRNASPLINLEYSNGWDPLAKDHGGSASSREVFKSFMFNLEDVERATQCFSKANLLGRNN
FSALYKGKLRDGSVVAIKCIGKTSCKSDEAEFLKGLKILISMNHENLVKFRGLCCSKDRG
ECYLIYDFVTNGTLMQYLDDNNGSGKILDWSTRVSIICGIAKGIGYLHRKIGKKPALIHQ
NISADKVLIDANYNPLLSDSGLHKLLADDIIFSMLKVSAALGYLPPEYTTTGRFTEKSDV
YAFGMIVLQIISGKTSIVKLNYNTIESRRFEDFIDSKLEGRFLESEADKLGKIAVICTHE
YPELRPTMDVIVQELDEMGTFGISVESMP
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtattccactcgttcttgatttccattttctttctggttttttcttccccttct
gctatttctgagtcgtccgagctttccattttaatggcgattaaagcttctttagacccg
cagaacactttgttgacgtcatggagtccgtcttcaaatccatgtggtggttatttcgaa
ggagttgcttgtaacgagcaaggaaaagtggtgaatatttctctgcaggggatggggctt
tccggctacattccggcagccgtcgctggacttaagagtttgacggggctgtacttgcat
ttcaatgctctaatcggcgaaattcctaaggaaattgcgagtttgactgaactgactgat
ttgtatctcaatgtgaatcaactctccggggagattccttttgagatcgggaatatggta
aatcttcaagtgctgcagctttgttacaacaaattaactggtgggataccgtcacaagtg
ggaaatatgaaggtgctcaatgttcttgctgtgcagtataatcagctaacaggagcaatt
cctgctagtttggggaacttgactgcgttaacacggttggacttgagtaacaacaagttt
ttcggtccaattccggtgatattagctgatgctcctgctcttgaagttcttaatgttcaa
aacaactcgctaaccggtaacgttcctccaggttttaggagattgaaggaaaagtttgtg
tacgataacaacccgagtctttgtggagtgggatttcgggacctgaatccttgtagtaag
ttgaaaagtttgaatccgagccgacccgaaccatttctaccccaactacctactaatctc
tctgcaagagatattcccgagtcagctaatttacgccacgattgcaatggaagtaactgt
ttgagacagtcgaaatcttcacgagtcggagtggctctcggagtgattggagtttttgct
gctttctcggccattggtcttgcaacgttttcatggtatcgtcgtaatgaacataaattc
ggaagtagttcaaatggtataagtagacgaatgattactagccaagtcagggaagtttac
aggaggaatgcttctcctctcatcaatctcgagtattcaaatggatgggatccgctagcc
aaagatcacggtgggagtgcatcgtcacgagaggtattcaagagcttcatgtttaatctc
gaagatgtcgagcgagcaacacaatgcttctcaaaggctaacttgttggggaggaacaac
ttttctgctctttacaagggaaagttgagagatggatcagttgttgctatcaagtgcatt
ggcaagacaagctgcaaatctgatgaagctgaattcttgaagggcttgaagatacttatc
tcgatgaaccatgaaaatctcgttaagttcagaggcttatgctgttcgaaagaccgagga
gagtgctatctgatctacgatttcgtcacgaatggaactttgatgcaatatcttgatgac
aacaatggcagcgggaagattctcgattggtccacccgagtgtcgatcatttgtggaatc
gctaaaggtataggatatttgcacagaaagattggaaagaaaccagcattgattcaccag
aacatatcagctgataaagtgctcattgatgcaaattacaaccccttgctatcagattct
ggcctgcacaaacttcttgcagatgacataattttctctatgctaaaagtcagtgctgca
ttgggatacctccctcccgagtacacgacgacaggtcgattcacggagaagagcgacgtc
tatgcatttggaatgatcgtacttcaaatcatatccgggaaaacaagcatcgtgaagttg
aactacaacactatcgagtcacgtcggtttgaggacttcattgactctaagcttgaagga
agattcttagaatcagaagcagataaactggggaaaattgcagtgatctgcacccacgaa
tatcccgagcttcgcccgacaatggatgtcatcgtccaagaactcgacgaaatgggaacg
tttgggatttctgtagagtcaatgccttga

DBGET integrated database retrieval system