KEGG   Cucurbita moschata (crookneck pumpkin): 111432017Help
Entry
111432017         CDS       T05248                                 

Definition
(RefSeq) glutathione transferase GST 23-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00480  Glutathione metabolism
cmos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111432017
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmos02000]
    111432017
Enzymes [BR:cmos01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     111432017
Transporters [BR:cmos02000]
 Other transporters
  Pores ion channels [TC:1]
   111432017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_N_4 GST_C_3
Motif
Other DBs
NCBI-GeneID: 111432017
NCBI-ProteinID: XP_022924577
Position
Unknown
AA seq 222 aa AA seqDB search
MGEVKLYGNWSSPFTYRVIWALAIKGIPYEYVEEDLSNKSPLLLHYNPIHKKVPVLVHGG
KPICESTLILEYINETWPQNPLFPADPLDRAAARFWIRFAEDKGPATWRMFCSGGEEHLK
AKWESLEMLQIVEERGIGEGKFFGGETIGMVDLVYGIFGDWLGVIEEVIGEKLVEADSFP
RLHAWIRAFLEAPTIRENRPDRDRMVVTFKALRERLLKSTSQ
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagtgaagctgtatgggaactggtcgagtcctttcacttacagagtcatatgg
gctttagccatcaaaggcataccctacgaatacgtagaagaagacctctccaacaaaagc
cctttgctccttcactataatcccatccacaagaaggtccctgtcctcgtccatggcgga
aaacccatctgcgaatccactctcatcctcgaatacatcaacgagacatggccgcagaat
cccctgttccccgccgatcccctcgaccgagccgcagctcggttttggattcgattcgcc
gaggataagggcccagcgacatggagaatgttctgttccggcggggaggaacacttgaag
gcgaagtgggagagcttggagatgctgcagatcgtggaagaaagaggcatcggcgagggg
aagttcttcggcggagagacgatcgggatggtggatttggtgtacggaatatttggagat
tggttgggagtgatcgaagaggtgatcggcgagaaactggtggaagccgattcatttcct
cggctgcacgcttggatcagggcttttctggaagctccgacgattcgagagaaccgtccc
gatcgagatcggatggtcgtcactttcaaggccttgagagagcggcttctgaaatcgaca
tcccagtaa

DBGET integrated database retrieval system