KEGG   Cucurbita moschata (crookneck pumpkin): 111434600Help
Entry
111434600         CDS       T05248                                 

Definition
(RefSeq) glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplastic-like
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00860  Porphyrin and chlorophyll metabolism
cmos01100  Metabolic pathways
cmos01110  Biosynthesis of secondary metabolites
Module
cmos_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    111434600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmos01007]
    111434600
Enzymes [BR:cmos01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     111434600
Amino acid related enzymes [BR:cmos01007]
 Aminotransferase (transaminase)
  Class III
   111434600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 111434600
NCBI-ProteinID: XP_022927826
Position
Unknown
AA seq 484 aa AA seqDB search
MEHSCSKQRDRGEKMAGALAGSLGIGLPCSTKLSHTTSRSSRLVRVKMAATLDEKKNFTL
KKSEEAFKAAKELMPGGVNSPVRAFKSVGGQPIIIDSVKGSHMWDIDGNEYVDYVGSWGP
AIIGHADDEVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMG
VLRLARAYTGKEKLIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKAATSETLTAPF
NDISAVESIFNANKGEIAALILEPVVGNSGFIPPKPDFLNAIRKLTKENNALLIFDEVMT
GFRLSYGGAQEYFGITPDLTTLGKIIGGGLPVGAYGGRREIMEMVAPAGPMYQAGTLSGN
PLAMTAGIHTLKRLKEPGTYEYLDKITSELVEGLVAAGKKAGHAICGGSINGMFGFFFTD
GPVYNFEDAKKSDTAKFGRFYRGMLEQGVYFAPSQYEAGFTSLAHTSEDVQHTIAAAEKV
FKQI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaacacagttgttcgaaacagagagatagaggagagaaaatggcaggcgctttagct
ggatcacttggaattggccttccatgttccaccaagctctctcacacaacttcacgctcc
tctcgtctagttcgtgtcaaaatggccgccacactcgacgagaagaagaacttcactctc
aagaaatctgaagaggctttcaaagctgctaaggagctaatgcctggtggagtgaattcc
cctgttcgtgccttcaaatctgttggtggacaaccaataattatcgattctgtaaagggc
tcccacatgtgggatattgatggtaatgaatacgttgattatgtgggttcttggggaccg
gcgattattggtcatgctgatgatgaggtacttgcagcccttggtgaaacaatgaagaaa
ggaaccagctttggcgctccatgccttttggaaaatgttttagcagagatggtgatatct
gctgttccaagcatagaaatggttcggtttgttaactctggtacagaagcatgcatgggt
gtgcttcggcttgcccgtgcttatactggaaaggagaaactcatcaaattcgagggatgc
taccacggccatgccgatccattccttgtcaaggcaggcagtggagtggcaacgttaggc
cttcctgattctcctggtgtccccaaagcagctacctctgaaactcttactgcccccttc
aatgacatatcagctgtagaatccattttcaacgccaataaaggagagattgctgcactt
atccttgagcctgtcgttggaaattctggcttcattcctccaaaacccgattttctaaat
gccatacgcaaacttaccaaggaaaacaacgctctcctcatctttgatgaggtcatgaca
ggattccgtttgtcttatggtggagctcaggagtatttcggaataacacccgacttaaca
acgctcggaaagatcattggcggtggtctgcctgttggtgcatatggaggacgaagagag
atcatggaaatggtagcaccagctggaccaatgtatcaggcaggtaccttgagcgggaat
ccattagcaatgactgcagggatacacacactaaagcgattgaaagaaccgggaacctac
gagtatctggacaagatcacgagcgaacttgttgaaggtttggtagctgcagggaagaag
gctgggcatgcaatatgtggaggctccataaatggaatgttcgggtttttcttcaccgat
ggccctgtttacaactttgaagatgctaaaaagagtgacacagccaaatttgggaggttt
tacaggggaatgttggagcaaggcgtatactttgccccttcacagtatgaggctgggttt
accagcttggcacatacatctgaagatgttcaacatactatagcagcagctgagaaggtt
ttcaagcaaatttag

DBGET integrated database retrieval system