KEGG   Cucurbita moschata (crookneck pumpkin): 111438129Help
Entry
111438129         CDS       T05248                                 

Definition
(RefSeq) ribonuclease II, chloroplastic/mitochondrial-like
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmos03016]
    111438129
Enzymes [BR:cmos01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     111438129
Transfer RNA biogenesis [BR:cmos03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    111438129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-GeneID: 111438129
NCBI-ProteinID: XP_022931839
Position
Unknown
AA seq 789 aa AA seqDB search
MALRAANSCSVFRSASSPPLSAFRTCLFNDRSSKLKYRYPVLWHKQQRFRSGGQRFYSLY
SIVENVVEELEALRRRKRPSATAKMGLVDMGSGELTEDKLMNQTLEKGRLLEFKKDSERV
LLAVAQRPDGKKNWMVFDQNGVTSSIKPQQVTYIVPGVENFDQTEIADFIKRAQNNLDPT
LLEFAWLELLEQNKAVTTEELAEMIFGNTEPLDSYCAHLLLSRDELYFTVLQTKGSRSFY
GPRPTDQVEELQRTKLAREAAENELQKFVELLKSAKAMPLKAKPPKSSWVTEEKTRHKIE
SLESYAIDSCKDAEQRITAGMILKAMGLVKTASSAVNLLIDIGYFPWHVNLELLKLNIRT
DHSDEIIAAAESLLLEASDADEVNRKNLTHLKVYAIDVDEADELDDALSATRLSDGRIKI
WIHVADPARFVRPGSIVDREAMKRGTSIFLPTATYPMFPEKLAMEGMSLKQGETCNAVTV
SVVLHSDGSIAEYSVENSIIKPTYMLTYESASELLSLNLEEEAELKTLSEAATLRLAWRR
QQGAIDMASLETRIKVANPQDLDPEINLYVENQADPAMRLVSEMMILCGEVIATFGYHHN
IPLPYRGQPQTNVDISAFAHLQEGPVRSSAIVRTMRAAEIDFRKPIRHGTLGIPGYVQFT
SPIRRYMDLLAHYQVKAFLRGDSPPYSHGQLEGMASTVNINTKLAKKLSSTSLRYWVLEY
LRRQPKENRYRALILRFIKDRIAALLLVEVGLQASAWVSVGAQIGDEVQVRVEEAHPRDD
VLSLKEIIH
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgcgagctgctaatagttgctcggttttccgctccgcttcgtccccgcctctc
tctgccttccgaacatgcctcttcaatgacaggagctcgaaattgaagtataggtatcct
gtattatggcacaaacaacaacgttttaggagtggcggacagcgattctactccttgtat
agtatagtcgaaaacgttgtcgaagagctcgaagctctgcgcaggcgaaagagaccttct
gctaccgctaaaatgggattggtggatatgggcagtggagagcttaccgaagataagctt
atgaaccagacattggaaaagggacggttactggagttcaagaaggactcggagagggtg
ctactggcagttgctcagagacctgatgggaaaaaaaactggatggtgttcgatcagaat
ggtgtgacatcatccattaagccacagcaagttacatacattgttccaggtgttgaaaat
tttgaccagacagaaattgcagacttcattaagagagctcagaataacttggatccaacg
ctgctggagttcgcttggcttgagcttcttgaacaaaataaggcagtgactaccgaagaa
ctagctgagatgatatttgggaatacagaacctcttgatagctattgtgcgcatctgttg
ttatcaagagatgagttatacttcactgttctgcagacaaaaggttcgcgatctttttat
ggtccaagacccactgatcaagttgaagaacttcaacgtactaagcttgcaagggaagcc
gctgaaaatgagcttcaaaagtttgtagaattgctgaaatctgctaaggcgatgcctttg
aaggctaaacctcctaaatcttcctgggtaactgaagagaaaaccagacacaagattgag
tctctcgaatcttatgctattgattcttgcaaggatgctgaacaaaggataacagctggg
atgattctcaaggccatgggactggtgaaaacagcatcatcagcggttaatcttctcata
gacataggatatttcccttggcatgttaatcttgaacttctgaagttaaacattcggaca
gatcattcagatgaaattatagcagcagctgaatcacttttactggaggcatctgatgct
gatgaggttaacaggaagaatctcacacatttgaaggtttatgccattgatgttgatgaa
gcagatgagcttgatgatgccttgagtgcaacaagattgtcagatggccgaattaaaata
tggattcatgttgccgatccagctagatttgttcgaccagggagcatagtagacagggag
gccatgaaaagaggcacttctatatttcttccgacagccacataccctatgtttcctgaa
aaactagcaatggagggaatgagtttaaaacagggagagacttgcaatgcagttactgta
tctgttgtccttcattctgatggaagcattgcagaatactctgtggaaaactcaatcatc
aaaccaacgtacatgctgacatatgaaagtgcttctgagctgcttagtttgaacttggaa
gaggaggcagaacttaaaactctatctgaagctgcaactttgcgtttagcatggcgaagg
caacagggggcgattgacatggcctctttggagacacggatcaaggtagcaaatccacaa
gacctggatcctgaaatcaatctctatgtggagaaccaagctgatcctgccatgcgactg
gtttctgagatgatgattctatgtggagaagttatagcaacttttggatatcaccataac
attccgttgccctatagaggacagccccaaacaaatgtagatatatctgcatttgcacat
cttcaagaaggacctgttaggagctctgcaattgttagaacaatgcgtgctgctgaaata
gatttcaggaagccgatacgccatgggactttgggaattcctggttatgtccaatttaca
tctcccatccgtagatatatggatcttcttgcacattatcaggtaaaggcattccttagg
ggtgactctcctccgtattcccatggtcagttagaaggaatggcatcaactgtgaatata
aatactaaattggcaaagaagctctcaagcaccagtcttcgttattgggtattagagtac
ttgagaaggcaaccaaaagaaaatagatatcgggcattgattcttaggttcattaaagat
cgaattgcagccctgctgttggtcgaggtgggactccaagcatctgcgtgggtatctgtt
ggagcacaaattggagatgaagtgcaagttcgagtggaggaagcccatccacgtgatgat
gtcctttctctgaaggagattattcactag

DBGET integrated database retrieval system