KEGG   Cucurbita moschata (crookneck pumpkin): 111440345Help
Entry
111440345         CDS       T05248                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: (+)-gamma-cadinene synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    111440345
Enzymes [BR:cmos01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     111440345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth Inhibitor_G39P ANTAR GCR1_C
Motif
Other DBs
NCBI-GeneID: 111440345
NCBI-ProteinID: XP_022933272
Position
Unknown
AA seq 561 aa AA seqDB search
MPHQTSLVSASSMKSPDNLKAKRPIANFHPSIWKDQFLSLSSEAMKIDVEVEEQAKQFKG
EVKKMLISSNRNHFKILNLVDSIQRLNVSYHFENEIDQILEQIYANYREFTNIDGNDDLY
TISLLFRLLRQQGYKISCDIFTKFIESNGKFKESLAEDARGILSLYEAAHMRVHGEDXLE
EALDFSVKHLKNIISNSSPIFVAEVTSALKYPLRKAIPRMKAREYIPIYQEDPSHSKTLL
TFSKLDFNVLQKLHQKELIEVIRWWKDLKVETNFSFARDRIVECYLWTLGVYFEPQFSVG
RKMLTKVTAISSILDDIYDAYGTFEELQVLTLAIQRWDRSMVNVLPEYMKPFYIAMLDLY
KEISKEIDKDGSSLHVHIAKEIKKLAESYFEEAKWLSKNYKPNFKEHIELALYTTGYSLL
ISISLLGMGNMVTNDVLQWVSRRPKIIKGSTIICRLMDDIVSHKFEQERKHVASAVECYI
EQYGCXEEEACVELHKQVVDAWKDVNEACLHPITVPMPILMRAVNFSRVMNVIYSDEDGY
TNSNGKTKFIIESLLVNSVPC
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatcaaacttctcttgtttctgcttcatctatgaagagcccagacaatcttaaa
gccaaacgtcctattgcaaactttcatccaagcatatggaaggaccagttcctttcacta
tcatccgaagcaatgaaaatagatgttgaggtggaggaacaagcaaaacagtttaaagga
gaagtgaaaaagatgctaataagttctaatagaaatcattttaagatactgaatctagtt
gattcaattcaacggttaaatgtatcttatcattttgagaacgagattgatcaaatctta
gaacaaatatatgcaaactatagagagttcacaaatattgatggcaatgatgatctttat
acgatctctcttctatttcgactccttagacaacaaggttataaaatttcttgcgacata
ttcacaaaatttatagaaagtaatggaaagttcaaagaatcactagcggaagatgcaaga
ggaattttaagtctatatgaagcggcacatatgagggtacatggagaagatngtcttgag
gaagctctcgattttagtgtcaaacatctaaaaaatattatatccaactcaagcccaatt
tttgtcgctgaagttacgagcgccttgaaatatcctctaagaaaagccattccaagaatg
aaggcaagagagtacataccaatatatcaagaagatccttcacattctaaaactttgctt
actttctcaaaattggatttcaacgtattacagaaacttcatcaaaaggagttgatagaa
gtcatcaggtggtggaaggatttaaaggtcgaaaccaatttttcttttgcaagagacaga
atcgttgagtgctacttatggacgttgggggtatattttgagcctcaattcagtgttggt
agaaagatgttaaccaaagtaaccgccatttcttcaattttagatgatatatatgatgcc
tatggaacatttgaagaactccaagtcctcactctagctattcaaaggtgggatagaagc
atggttaatgtactcccggagtacatgaaacctttttatatagcaatgttagatctttat
aaagaaattagtaaagagatagacaaggatggaagttcactccacgttcatattgcgaaa
gaaataaagaaactagcggaatcctactttgaagaagctaaatggttaagcaaaaattac
aaaccaaattttaaggagcacatagaattggcattatatacaacaggttattccttgctt
ataagcatttcacttctcggcatgggcaacatggtaacgaatgatgtacttcaatgggtt
tctagaagacctaaaattattaaaggctcaacaatcatttgtagactcatggacgacatc
gtttcccacaagtttgagcaagaaaggaaacatgttgcttctgcagttgaatgttacata
gagcaatatggttgttaagaggaagaagcttgtgttgaacttcataagcaagtggttgat
gcatggaaggatgtaaatgaagcatgtcttcatccaattactgttccaatgcctatttta
atgcgggcagtaaatttttcaagagttatgaacgtaatttattcggatgaggatggatac
acaaattcaaatggcaaaacaaaatttattattgaatctcttcttgtaaactccgtgcct
tgttga

DBGET integrated database retrieval system