KEGG   Cucurbita moschata (crookneck pumpkin): 111441641Help
Entry
111441641         CDS       T05248                                 

Definition
(RefSeq) putative serine/threonine-protein kinase isoform X1
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase ABC1 APH
Motif
Other DBs
NCBI-GeneID: 111441641
NCBI-ProteinID: XP_022934471
Position
Unknown
AA seq 387 aa AA seqDB search
MASCCFAILNCCKGNSSSEEPAEGIAVNNNVRIFSYNSLRSATSNFHPSSRIGAGGYGVV
YKGVLRDGTNVAVKSLSAESTQGTREFLTEINMISDIRHQNLVELIGCCVEGTHRILVYE
YLENNSLANTLLGSLSKDVVLDWPMRAKICLGTALGLAFLHEEAEPSVVHRDIKASNILL
DRNFDPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGVLMLE
VISGSSSTKAAFGEELLILVEWTWKLKQEGRLVELIDPELINYPKAEVVRFITVALFCTQ
AAANQRPTMKQVVEMLSREVHLNEKLLTEPGVYKGHKTRKLNGGAAAASISGGTSSSHGI
KYKKAMKTSPSSSQFNSSNSLTQMLPR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctgttgctttgcaatcctgaattgctgtaaaggaaatagcagctcagaagaa
ccggcagaagggattgctgttaacaacaatgtacgcatcttttcttataattcactgagg
tcagccactagtaattttcatccatcaagcagaataggtgctggaggttatggagttgtc
tacaaaggagttttgagggatggtaccaatgttgcagtaaaatcactgtctgcagaatct
acccagggaactcgtgaatttttaaccgagataaatatgatatcagatataagacatcaa
aatctagttgaactgatcggttgttgcgtcgaaggcacgcatcgaattttggtgtatgaa
tacctggaaaacaacagccttgcgaatactttgcttggttcattgagtaaggatgtcgtt
ctggattggccaatgagagctaagatttgtctcggtacagctttgggtcttgcatttctg
catgaggaagctgaaccgtctgttgttcatagagatatcaaggctagcaatatacttctt
gacagaaactttgatcctaaaataggagactttgggttggctaaacttttcccggacaac
gttactcatgttagtactcgagtggccggaactgttggatatttggctcccgagtatgca
ctcttaggacagttgacaaagaaggcagatgtatacagttttggtgtgctcatgctggaa
gtaatcagtggaagtagcagcaccaaggcagcatttggagaagagttgttgattctcgtg
gaatggacttggaaattaaaacaagaaggacggctcgtagaactcattgatccggaactg
atcaattatccaaaggccgaggtggtgcgtttcattacggttgcactcttctgtacccaa
gcagcagcaaatcaaaggccaaccatgaagcaggtcgtggaaatgctttcaagagaggta
caccttaacgaaaaactactgacagagcctggagtatacaaaggacacaaaactaggaag
ttaaatggtggtgctgctgctgcttctatttctgggggaacatcctcctcccatggaatc
aaatataaaaaagctatgaagacttctccatcttcatctcaatttaacagctcaaacagt
ctgactcaaatgcttcctaggtga

DBGET integrated database retrieval system