KEGG   Cucurbita moschata (crookneck pumpkin): 111444682Help
Entry
111444682         CDS       T05248                                 

Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase-like
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00072  Synthesis and degradation of ketone bodies
cmos00280  Valine, leucine and isoleucine degradation
cmos00650  Butanoate metabolism
cmos00900  Terpenoid backbone biosynthesis
cmos01100  Metabolic pathways
cmos01110  Biosynthesis of secondary metabolites
Module
cmos_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    111444682
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    111444682
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111444682
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    111444682
Enzymes [BR:cmos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     111444682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 111444682
NCBI-ProteinID: XP_022938452
Position
Unknown
AA seq 465 aa AA seqDB search
MAKNVGILAVDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTV
VTSLLEKYRIDPKQVGRLEVGSETVIDKSKSIKTFLMQIFEKHGNTDIEGVDSTNACYGG
TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIAFESK
LRGSHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKQLCHKYEKLEGKRFTISD
ADYFVFHSPYNKLVQKSFARLLFNDFKRNASSIDEVVKEKLAPFSTLSNDESYQSRDLEK
ITQQLAKPLYDSKVQPSTLIPKQVGNMYTASLYAAFISLLHNKHSSLSGNRVILFSYGSG
STATMFSLKINEGQHPFSLSNVAAILNVDKKLKSRRELVPEKFVEIMKLMEHRYGAKDFT
TNKDCSLLPPGTYYLTEVDSLYRRFYAKKDGECEKLDNGVVANGH
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaatgtgggaattctcgctgttgatatctacttccctcctacctgtgttcag
caggaagctttggaggctcatgatggagcaagcaaggggaaatacacgattgggctcgga
caggattgcatggcgttctgttctgaggttgaagatgtaatctcaatgagcttgacagtt
gtcacttcccttcttgagaagtatagaattgacccaaagcaagttggccggctggaagtt
ggcagtgagacagtgatagataaaagcaaatcaattaagactttcctgatgcaaattttt
gagaaacatggaaataccgatattgaaggtgttgattcaactaatgcatgctatgggggc
acagctgcccttttcaactgtgtcaattgggtggagagcagctcctgggatgggcgttat
ggtcttgtggtgtgcacagacagtgcggtctatgctgaaggaccagctcgtcctacaggt
ggggctgctgccattgccatgctgataggacctgatgctcctattgcttttgaaagcaag
ttgaggggaagtcatatgtctcatgtttacgatttttacaagcctaacctagccagcgaa
tacccggttgtagatggtaagctctctcaaacctgttacctcatggccctggattcttgc
tacaaacaattatgtcacaagtatgagaaactggagggcaaacggtttaccatttctgat
gctgactattttgtatttcattctccctataacaagcttgtgcagaagagctttgctcga
ttgctctttaacgacttcaagagaaacgcgagctcaatagacgaagtcgttaaagaaaag
ttggctccgttttcaaccttgtctaacgatgaaagttaccagagtcgggatcttgaaaag
ataactcaacaacttgcaaagcccctttatgattccaaggtgcaaccctccactttaata
ccaaagcaagttggaaatatgtatactgcttctctctatgcagcatttatttcgcttctt
cacaataagcatagctcactgtcaggaaatagggtgatattgttctcgtacggcagtggg
tcaaccgcaacgatgttctcattgaaaatcaatgaaggtcaacatccctttagtctctcc
aacgttgcagccatcttgaatgtagataaaaagttgaaatcgaggcgcgagttggtaccg
gagaaatttgtcgaaataatgaagctgatggagcatcggtacggggccaaggactttacg
acaaacaaggactgcagcctcctaccaccaggcacctactatctcaccgaagttgattca
ttgtacaggagattctacgctaagaaggatggcgaatgcgagaagcttgacaatggtgtg
gttgccaatggccactga

DBGET integrated database retrieval system