KEGG   Cucurbita moschata (crookneck pumpkin): 111446468Help
Entry
111446468         CDS       T05248                                 

Definition
(RefSeq) serine/threonine-protein kinase RIPK
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PIP49_C
Motif
Other DBs
NCBI-GeneID: 111446468
NCBI-ProteinID: XP_022941071
Position
Unknown
AA seq 403 aa AA seqDB search
MGMKRKMTWKSMIVSSCYKAESDDGDRHRVSKKGLSQRLSLSDASNPSSPLSIDDLSNSL
VGPKLHVFSFAQLRTITHNFASSNLLGEGGFGPVYKGFVDDKIKPGLEAQPVAVKLLDLH
GSQGHKEWLAEIIILGQMRHQNLVKLIGYCWEEEYRLLVYEYMARGSLENQLFRKYSAAL
PWSTRMRIALEAAKGLQFLHEADPPVIFRDFKTSNILLDSDYTTKLSDLGLAKDGVDCED
QPDMTCIMGTQGYAAPEYVKSGHLTTMSDVYSYGVVLVELLTGKPSMDRNTGEFLVDSVK
PLLKDSKRLSRVMDPRLEGMYSADGARKAAALAHKCLSRNPKRRPPATEVVNVLKSLQDF
NDVFTAPFVYVVEDCCVEEGKKENGLGLGLGGLGWKNWRPISV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgaagaggaagatgacgtggaaatcgatgatcgtttcgagttgttacaaggcg
gagtccgacgacggcgaccggcaccgggtttcgaagaaaggtttgtcgcagaggctgtcg
ctgtcggacgcgagtaacccgagctcgcccttgtcgatcgacgacctgtccaattctctc
gtcggacccaagcttcatgtcttctcattcgctcaacttcgaaccatcactcacaatttt
gcctcgtcgaatttgcttggagaaggcgggttcggtccggtctacaaagggtttgtcgat
gataagattaaaccgggtttggaggctcagccggtcgccgttaaattgctcgacctccac
ggatctcaaggccataaagaatggctggcagagataataattttgggtcaaatgaggcat
caaaatttggtgaaacttatcggttattgctgggaagaagagtacaggcttttggtttat
gagtatatggccagaggcagtttagaaaaccagctttttagaaagtattcggctgctttg
ccttggtcaacgaggatgagaatcgctttagaagctgccaaaggccttcaattccttcat
gaagccgatcctcccgttatatttagagatttcaaaacctccaatattcttctcgattct
gattatacgacgaagctctcagatcttgggttggctaaagatggcgttgactgcgaagac
caacccgacatgacttgtattatgggcactcaaggctatgccgctcctgagtacgtcaaa
tccggccatttgacgacaatgagcgatgtgtacagttacggggttgttttggtagagctg
ctgacggggaagccgtcgatggaccgaaacacgggcgagtttctagtggactcggtcaag
ccacttctaaaggactccaaacggctcagccgagtcatggacccaaggcttgaggggatg
tactcggccgacggcgctcgtaaggctgctgccttagctcataaatgtctcagccgcaac
cccaagaggcggccgcctgcgacggaagtcgttaacgtgttgaagtccttgcaggacttt
aatgacgtgtttacggcgccgtttgtgtacgtggtggaggattgctgcgtggaggagggg
aagaaggaaaatgggcttgggcttgggcttggtgggctgggctggaaaaactggaggccc
atatctgtatga

DBGET integrated database retrieval system