KEGG   Cucurbita moschata (crookneck pumpkin): 111446767Help
Entry
111446767         CDS       T05248                                 

Definition
(RefSeq) aldehyde dehydrogenase family 3 member H1-like isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00010  Glycolysis / Gluconeogenesis
cmos00053  Ascorbate and aldarate metabolism
cmos00071  Fatty acid degradation
cmos00280  Valine, leucine and isoleucine degradation
cmos00310  Lysine degradation
cmos00330  Arginine and proline metabolism
cmos00340  Histidine metabolism
cmos00380  Tryptophan metabolism
cmos00410  beta-Alanine metabolism
cmos00561  Glycerolipid metabolism
cmos00620  Pyruvate metabolism
cmos00903  Limonene and pinene degradation
cmos01100  Metabolic pathways
cmos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111446767
   00053 Ascorbate and aldarate metabolism
    111446767
   00620 Pyruvate metabolism
    111446767
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111446767
   00561 Glycerolipid metabolism
    111446767
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111446767
   00310 Lysine degradation
    111446767
   00330 Arginine and proline metabolism
    111446767
   00340 Histidine metabolism
    111446767
   00380 Tryptophan metabolism
    111446767
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111446767
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    111446767
Enzymes [BR:cmos01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     111446767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 111446767
NCBI-ProteinID: XP_022941484
Position
Unknown
AA seq 495 aa AA seqDB search
MSDTDTDTDTETETKAEAEVYDASMQVKELRESFASGKTRCYKWRVSQLESLFKLSVVHE
EDICDALRSDLSKPVMEAIIHEIALLKNSCKLALKELRRWMTPEKVKTSITTFPSSAAIV
PEPLGVVLIISAWNYPFLLSLDPVVGAIAAGNAVVLKPSEISPATSSLMAKLVGKYLDTS
AVKVIEGATSETSALLEQKWDKIFYTGSGRVGRIVMAAAAKHLTPVVLELGGKSPVVVDS
QINLQVACRRIIAGKWGCNNGQACIAPDYIITTKGFAPKLVETLKQELERFYGKNPMETK
DLSRIVNANHFARLSKLLDDDKVSGKIVHGGERDKAKLQITPTLLLDVPRDSLIMTEEIF
GPLLPILTVDKVEDSFEVVNSGTKPLAAYLFTNNKRLKDQFVACISAGGVAINDTTLHLT
VSTLPFGGVGDSGMGSYHGKFSFDAFSHKKAVLYRSFTGDAPMRYPPYTKGKLRILKALL
GGDIWGLIRALFGWS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatacggatacggatacggatacggagacggagacgaaggcggaggcggaggtg
tatgacgcgtcgatgcaggtgaaggagttgagagaaagttttgcctccggaaagactcgg
tgctataagtggagagtttcgcagcttgagagtctcttcaagcttagcgttgttcacgag
gaagatatctgcgatgcgcttcgctctgacctatccaagcctgtgatggaagccattatt
catgagatagctttgttgaaaaattcatgtaaattggcacttaaagaactcaggcgttgg
atgacgccagaaaaggttaaaacttcaattaccacatttccttcgtctgctgcaattgta
ccagaacctctgggtgttgtcctgatcatttctgcttggaattatccattcttattatct
cttgatccagttgttggagcaatagcagctggtaatgctgtggttctaaagccatcagaa
atttccccagcaacatcatctttaatggcaaaacttgtagggaaatatttggatacttct
gctgtaaaagttattgagggtgctacttccgaaacttctgctttgctggagcaaaaatgg
gacaaaatattttacacaggcagtggaagagtggggcgtatagttatggcagctgctgcc
aagcaccttacaccagtcgttttggagcttggaggaaaatctccagtagtagttgattca
caaatcaatttacaagtcgcgtgtaggcggattattgctggtaagtggggttgcaacaat
gggcaagcatgcattgctcctgattatatcataactacgaaaggatttgctccaaaattg
gtggagactctgaaacaagaactggagagattttatggaaagaaccctatggaaactaaa
gatttgtctcgcattgtgaatgctaaccactttgctcgcttgtcaaagctcttagatgat
gataaggtttctggcaagattgtgcatggaggtgaaagggacaaagccaaattacagatt
actccgaccctcttattggatgtccctcgagactctctgattatgacggaggagatcttc
ggtcccttgcttcctattctcacggtcgacaaagtggaggatagcttcgaagtagtgaac
tcgggcacaaagccacttgcagcatatttatttaccaacaacaagaggctcaaggaccag
ttcgtagcttgcatctctgcagggggtgtggccatcaatgacaccaccttacatctgaca
gttagcacactaccatttggaggagttggggacagtggaatgggatcttaccatgggaag
ttctcatttgatgcatttagccataagaaggctgttctttatcgaagcttcacaggcgat
gcgccgatgagatacccgccgtacacgaagggaaagctaagaattctcaaggctcttctt
ggaggtgacatatggggtctcattcgtgctctttttgggtggtcatag

DBGET integrated database retrieval system