KEGG   Cucurbita moschata (crookneck pumpkin): 111446792Help
Entry
111446792         CDS       T05248                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP18, chloroplastic
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111446792
Enzymes [BR:cmos01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     111446792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 111446792
NCBI-ProteinID: XP_022941513
Position
Unknown
AA seq 228 aa AA seqDB search
MAVAITKSLDSCPIHRLLPQIRSQSTANRRENASQELFSLPISRRSVILISSLPLALVSV
SPSSEARERRSRKTIPLEDYLTSPNGLKYYDIEEGKGPVAEKGSTVQVHFDCLYRGITAV
SSRESKLLAGNRIIAQPYEFKVGAPPGKERKRDFVDNPNGLFSAQAAPKPPPAMYSITEG
MKVGGKRTVIVPPEAGYGQKGMNEIPPGATFELNIELLEVVQPDKGGA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggccataactaagagcttggattcttgtcccattcatcgccttcttcctcaa
attcgttcacaatctacggccaacagaagagaaaatgctagccaagaattgttctctctt
ccaatttcaagaaggtctgtgattttgatctcctcgctacctctcgctcttgtttccgta
tctccgtcgtccgaggcaagagagagaaggagcaggaagactattcctctcgaggactat
ctcaccagccccaatggactgaagtactatgatatcgaggagggaaagggtcctgtggct
gagaagggttccacagtacaggttcactttgattgcctctatagagggattacagctgtg
tcaagtcgagaatctaaactcttggctggaaatcgtataatcgcccagccttatgagttc
aaagtaggagcccctcccgggaaggagaggaaacgtgattttgtggacaatccaaatggc
ctgttttcagcacaggctgcacctaaacccccaccagcaatgtactccataactgaaggg
atgaaagttgggggaaagcgaacggtgattgttccccctgaggctggatatggtcaaaag
ggaatgaatgaaatcccacctggagctacttttgaattgaacatcgagcttttagaagtg
gtgcagcctgataaaggtggggcctga

DBGET integrated database retrieval system