KEGG   Cucurbita moschata (crookneck pumpkin): 111447458Help
Entry
111447458         CDS       T05248                                 

Definition
(RefSeq) methionine S-methyltransferase-like isoform X1
  KO
K08247  methionine S-methyltransferase [EC:2.1.1.12]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00450  Selenocompound metabolism
cmos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    111447458
Enzymes [BR:cmos01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.12  methionine S-methyltransferase
     111447458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 MTS PrmA Methyltransf_31 Methyltransf_25 Met_10 Methyltransf_32 Methyltransf_12 Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 111447458
NCBI-ProteinID: XP_022942400
Position
Unknown
AA seq 1080 aa AA seqDB search
MASVLDSIDEFLSRCQQSGDAAYAALRSVLDRLDDPATRVRARVFLDDIKRRFPTKDDCD
RCFSSYHFRIDDIFLDQYEGYHGRKKLSSMVIPSIFIPEDWSFTFFEGLNRPPDSIFKDQ
TVAELGCGNGWISIAIADKWLPFKVYGLDINPRAVKISWINLYLNALDEKGQPILDSENR
TLLDRVEFHESDLLAYCRDNDIQLERIVGCIPQILNPNPDAMSKMITENASEEFLHSLSN
YCALQGFVEDQFGLGLIARAVEEGISVIKSTGIMIFNMGGRPGQGVCKRLFERRGFRITK
LWQTKILQAADTDISALVEIEKNSPHRFEFFMGLSGDQPICARTAWAYGKAGGRISHALS
VYSCQLRQPNQVKTIFDFLKSGFQEISGSLDLSFQDDSVADEKISFLAYLGSIFKETACF
PYEPPAGSLRFRSLIAGFMKKYHHIPLNSGNVVVFPSRAVAIENALRLFSPRLAIVDEHL
TRHLPRQWLTSLNIETGIGRAADDVRTVIEAPSQSDLMIELIKKLKPQVVVTGMAHFEAV
TSSAFVQLLDVTREIGSRLFIDISDHFELSSLPSSNGVLKYLAGNSLPSHAAILCGLVKN
QVYMDLEVAFVISEEEPILKALSKTVELLEGNTAPISQYYYGCLFHELLSFQLPDRHLPA
QRKCDKSASSTDIIGFSSSAISVLNNAELSIDQIENSYLIHMDVDQSFLPTPFPVKAAIF
ESFSRQNMSESEIDITTSIKQFVKTTYGFPFGTDFTYADSSLTLFNKMVLCCIQEGGTLC
FPVGTNGSYVYSAKFLKAKIVNIPTKSEEGFKLTECALNQALNNVKTPWVYISGPTINPT
GRVYDQKEIENLLTTCAKFGARVIIDTSFSGLEFDYEGWGGWNLEGVLSRLYLSSSSFSV
CLLGELSSMMLTGALKFGFLALNQLPLIDLFHSFSGLSRPHSTVKYAIKKLLGLREKKSE
EMWGAVTRQIKDLRSRSRRLAETLGSCGWDVLEPHAGFSTVAKPTLYSNKTTRLKNAIDY
EVKLDDSNIRGAILKATGLCINSSSWTGIPGYCRFTIALEESEFQKALDCIAEFKRIACL
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggttttggactccattgatgagtttttgagtcgctgtcagcagtctggcgac
gccgcttacgccgctctccgttccgtcctcgaccgacttgatgatccggctaccagagtt
agagctcgtgtgtttctcgacgatattaagaggcgttttcctaccaaggatgattgcgat
cggtgcttctcctcttaccatttccggatcgatgatatctttctcgaccaatacgaaggt
taccacgggaggaagaaactgagttcaatggtaatccccagcattttcatcccggaagat
tggtcatttacttttttcgagggattgaataggcccccagattccatatttaaggatcaa
acagtggctgagcttggttgtggaaatgggtggatatccatcgccattgctgacaaatgg
ttacctttcaaggtctacggccttgatatcaaccctcgagcagtcaagatctcttggatt
aatctatatttaaacgctctggatgagaagggccaacccatacttgacagtgagaacaga
acccttttggatagagtggagttccatgaatctgatctgctggcctactgtagagataat
gacatccaacttgagcgaattgttggatgcattcctcagattcttaacccaaatccagat
gctatgtccaagatgattaccgaaaacgctagtgaggaatttttgcactcgttgagtaac
tattgtgcacttcaaggttttgttgaagatcaatttggattaggtctgatagccagggca
gtagaggaaggaataagtgttatcaaatctacagggattatgatcttcaatatgggagga
cgtcccggacaaggcgtttgcaagcgcttattcgaacggcgtggcttccgcattaccaag
ctttggcagaccaaaattcttcaggcggctgatactgacatctctgccttagttgaaatt
gagaagaacagtccgcatcgttttgagttttttatgggactttcaggggatcagcctatt
tgtgctcgcacagcatgggcttatgggaaggctggtggtcgcatctctcatgcactatca
gtttatagctgccaactccgtcagccaaatcaggttaagacaatatttgattttcttaag
agtggattccaagaaatcagcggttcattagatttatcatttcaagatgattctgttgct
gatgagaagatttcattcctagcttatcttggcagcatatttaaagaaactgcatgtttt
ccatatgagccaccggctggaagcttgcgtttccgaagccttattgctggatttatgaaa
aaataccaccacataccactcaattctggtaatgttgtggtttttccttcgagggctgtg
gccattgagaatgctctgcgcttgttctcccctcgacttgccattgtggatgagcatcta
actcgacacctaccaagacaatggttaacttctctcaatattgagactggaattggtcgt
gccgcagacgatgtacgtacagttattgaggctccgagccagtccgatttaatgatcgag
ctgataaagaagctgaaacctcaggtagtggtgactgggatggctcattttgaagctgtt
actagctcagcttttgtgcagcttttggatgttacaagagaaataggttcccgtctcttc
atagacatatcagaccactttgagctatccagtcttcctagttccaatggcgtcctaaag
tatttagcaggaaactctcttccttctcatgcagctattttgtgcggcctagtgaaaaat
caggtatatatggatttagaagtggcttttgttatttctgaagaagaaccaattcttaag
gccttgtccaagaccgtagaattgttagaagggaacactgcacccataagtcaatattat
tatggatgtcttttccatgagctactttcttttcagctacctgatcgacatctaccagca
cagagaaaatgtgacaaaagtgcaagctcaacagacataattgggttttccagttctgcc
atctcagttctgaataatgctgagctatcaattgaccagattgaaaattcatacctgatt
cacatggatgttgatcagagcttcctgcctactccatttccagtcaaagctgcaatcttt
gaaagtttttcaagacagaacatgtcagagtcagaaatagatatcaccactagcatcaag
caatttgtcaaaaccacttatgggttcccatttggtacagactttacgtatgctgatagc
tcgttaacattgtttaacaagatggttctctgttgcatccaagaaggaggaacactgtgt
tttccggttgggacgaacggaagctacgtttacagtgccaagtttttaaaggcaaaaatt
gtaaatatacctaccaaatccgaagagggattcaagctaacagagtgtgcacttaatcaa
gcactcaataatgtgaaaaccccgtgggtttacatatctggtccaacaattaacccaact
ggtcgagtttatgaccagaaagaaatagagaatttgttaactacttgtgctaaatttggg
gccagggtcatcattgatacttcattttcagggttggaatttgattatgagggttggggc
ggctggaatctggaaggagttctatctaggctttatctgtctagcagttcattttctgtt
tgcctgcttggagaactatcatcgatgatgctaacgggtgccctcaaatttggttttctg
gctttgaaccaactgcctttgatcgacttgtttcatagcttctcgggattaagtcgacct
catagcacagtgaaatatgctataaagaagttgctaggactaagagagaagaagtcagaa
gagatgtggggtgctgtaaccagacagattaaggacctgagaagtagatccagacgcctg
gcagagacacttgggagctgtggatgggatgtgctcgagccccatgccgggttttctacg
gttgccaagccaactctttattcgaacaagacaaccagactgaagaacgccattgattac
gaagtgaagctcgatgattcaaacatcagaggagccatcctgaaggccactggcttatgc
atcaacagcagctcatggacaggaattcctggatactgccggttcacaatagcgttggag
gaaagtgaatttcagaaggcattggattgtattgctgagttcaaaagaattgcctgctta
taa

DBGET integrated database retrieval system