KEGG   Cucurbita moschata (crookneck pumpkin): 111449952Help
Entry
111449952         CDS       T05248                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00630  Glyoxylate and dicarboxylate metabolism
cmos00710  Carbon fixation in photosynthetic organisms
cmos01100  Metabolic pathways
cmos01110  Biosynthesis of secondary metabolites
cmos01200  Carbon metabolism
Module
cmos_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cmos_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cmos_M00532  Photorespiration
cmos_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    111449952
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111449952
Enzymes [BR:cmos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     111449952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 111449952
NCBI-ProteinID: XP_022945823
Position
Unknown
AA seq 181 aa AA seqDB search
MASIVSSAAAVASVNRASPAQASMVAPYTGLKSTAGFPVTRKNNDITTLASNGSRVRCMK
VWPPLGLKKFETLSYLPDLTSEQLLKEIGYLLRSGWVPCIEFELEKGFVYRENHRSPGYY
DGRYWTMWKLPMFGCTDPAQVAAEIEEAKKEYPNAFIRVIGFDNVRQVQCISFIVYKPAS
Y
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcttccattgtctcctccgccgccgctgtcgcctccgtgaacagggcttcccctgct
caagctagcatggtagcaccctacactgggctgaaatccaccgccggcttccctgtcacc
cggaagaacaacgacatcaccactcttgctagcaatggtagcagagttcggtgcatgaag
gtgtggccaccacttggattgaagaagtttgagactctgtcttacctgcctgatcttacc
agtgaacaattgttgaaggaaattgggtaccttctccgctctggctgggttccctgcatc
gagttcgagttggagaagggatttgtgtaccgtgagaaccacaggtcgccgggatactac
gacggacggtactggaccatgtggaagctgcccatgttcgggtgcacagacccagctcag
gtggcggctgagatcgaggaggccaagaaggagtaccccaacgcattcatcagggtcatt
gggtttgacaatgtccgccaagtgcagtgcatcagtttcattgtctacaagcctgcatcc
tactaa

DBGET integrated database retrieval system