KEGG   Cucurbita moschata (crookneck pumpkin): 111450046Help
Entry
111450046         CDS       T05248                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00520  Amino sugar and nucleotide sugar metabolism
cmos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    111450046
Enzymes [BR:cmos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     111450046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 TrkA_N adh_short KR
Motif
Other DBs
NCBI-GeneID: 111450046
NCBI-ProteinID: XP_022945962
Position
Unknown
AA seq 438 aa AA seqDB search
MQSIKQLHKQSSINHRRDEEVSTVSTSPYSPKALKHPRSLPRSINYLFREQRLLFVFVGI
LIGSTFFILQPTLSRIGPSEAGSAIRRSFSTSLTSRDEVSGSGIYGFGKTGGRIPVGIGR
RRWRIVVTGGAGFVGSHLVDKLIERGDDVIVIDNFFTGRKENLVHHLRNPRFELIRHDVV
EPILLEVDQIYHLACPASPVHYKYNPVKTIKTNVMGTLNMLGLAKRIGARFLLTSTSEVY
GDPLEHPQKETYWGNVNPIGERSCYDEGKRTAETLAMDYHRGAEVEVRIARIFNTYGPRM
CLDDGRVVSNFVAQAIRKQPLTVYGDGKQTRSFQYVSDLVNGLVALMEGEHVGPFNLGNP
GEFTMLELAEVVKETIDPSATIEFRANTADDPHKRKPDISKAKSLLNWEPKVALREGLPL
MVSDFQKRILIEDEGKGF
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcatcaaacagctccataagcaatccagcatcaatcaccggcgggatgaagaa
gtttcgacggtttcaacatcgccgtattcgccaaaagctctcaagcaccccagatctctg
cctagatccatcaattacctgttccgagagcagaggcttctgtttgtttttgtcggcatt
ttaattggctctacgtttttcattctccagcccactctgtcccgtattggcccctctgaa
gctggttctgcaattcgcagatcgttttctacaagtttgacgagcagagacgaggtttcg
gggtcggggatatatggatttggtaaaacgggaggcagaatccccgtcggtattggccgc
cggaggtggaggattgttgtcaccggtggagctggatttgtgggaagtcatcttgtggat
aagctaattgaacgaggggatgatgtgattgtcattgataacttcttcactggtagaaag
gagaatttggtgcatcatttgcgaaatccacgattcgagctcattcgacatgatgtggtt
gagccaattcttttggaggtggatcaaatctatcacttggcttgtccagcttctcctgtt
cattacaagtacaatcctgtcaagactattaagacaaatgtaatgggtaccttgaatatg
cttggcttggcaaagagaattggggctagatttctacttacgagtacgagtgaggtttat
ggtgatccacttgagcatcctcagaaggaaacatattggggaaatgtaaatcccataggc
gagagaagctgctatgatgagggcaagagaactgcagagaccttagctatggattatcat
agaggtgctgaagttgaggttcgaattgctcgtatttttaatacatacggaccccgtatg
tgtttagatgatgggcgtgttgttagcaactttgttgcacaggccatccgcaaacagcca
ttgactgtttatggtgatggaaagcaaacacggagctttcaatatgtctctgacttggtt
aacggactggtcgcgctaatggaaggtgaacatgtagggcctttcaacttgggtaatcca
ggagaatttaccatgcttgagctggctgaggttgtcaaagaaactatagatccaagtgcg
acaatagagtttagagcaaatactgctgatgatcctcacaagagaaaacctgacattagc
aaagcaaagtcattgctcaactgggagcccaaggtcgccctgagagaaggactgcctctc
atggtgagcgacttccagaagcgcattttgattgaagatgaagggaaaggtttctaa

DBGET integrated database retrieval system