KEGG   Cucurbita moschata (crookneck pumpkin): 111450338Help
Entry
111450338         CDS       T05248                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111450338
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cmos03041]
    111450338
Enzymes [BR:cmos01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111450338
Spliceosome [BR:cmos03041]
 Complex C
  Other components
   Step II factors
    111450338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE ABC_tran Sigma54_activ_2 AAA_16 AAA_14 PhoH
Motif
Other DBs
NCBI-GeneID: 111450338
NCBI-ProteinID: XP_022946177
Position
Unknown
AA seq 1219 aa AA seqDB search
MVASAANGDDGLKKLEYLSLVSKVCSELETHLGFGDKVLAEFITEMGRRCETVDEFDSKL
KENGAEMPDYFVRSLLRIIHLILPPQKDDNEKEFKKEKESDGKKGKFRALAIGDDKERAK
ELVKEIELEAHQKRGDRDVQDDRYKGRAGDRGRDRDRDRDRDRDRDGDRNRDRDRDRYRD
RDKDRDRRRDRYERDERHGGRDRDDDGGDDYQRSGRPRDRNRRNGYEENEGYTGDTRDGN
GNRRDDRDKHTQNGRHLPVDHEPELYKVYKGRVSRVMDTGCFVQINDFRGKEGLVHVSQM
ATRRITNAKDVVKRDQEVYVKVISVSGQKLSLSMRDVDQHSGKDLLPLKKKDADDGPRMN
PSNTKDDGPVVRTGLSGIKIVEDDVTIPSRRPLKRMSSPERWEAKQLIASGVLSVNDYPS
YDDEGDGLLYQEEGAEEELEIELNEDEPEFLQGQSRYSIDMSPVKIFKNPEGSLSRAAAL
QSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAYDMPEW
KKDAYGKDISFGQKSKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVT
QYLAEAGYTTSGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIK
YMTDGMLLREILIDDNLSQYSVVMLDEAHERTIFTDVLFGLLKQLVKRRPDLRLIVTSAT
LDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPETDYLDAALITVLQIHLTEPEGDILLF
LTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFEPAPPGKRKVVVAT
NIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKC
YRLYTESAYRNEMSPTTIPEIQRINLGHTTLTMKAMGINDLLSFDFMDPPSPQALISAME
QLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFY
RPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVR
KQLLSIMDKYKLDVVSAGKNFTQIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSS
ALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVELAPRYFKVADPTKMSKRKRQERIE
PLYDRYHEPNSWRLSKRRA
NT seq 3660 nt NT seq  +upstreamnt  +downstreamnt
atggttgcttccgcggctaacggcgacgatggattgaagaagctcgagtacttgtccctc
gtttccaaggtatgttctgagctcgaaactcatttagggttcggagataaagtacttgct
gagttcataaccgagatggggcggagatgtgagacggtggacgagttcgattccaaattg
aaggagaacggtgctgaaatgcccgattactttgttcgctcgcttctgaggatcattcac
cttattcttcctccgcagaaggatgacaatgagaaggagttcaagaaggagaaggaatca
gatggaaaaaagggcaagtttagggccttggcgatcggggatgataaggagagagctaag
gagctcgtgaaggaaattgagttggaggctcaccagaagcgtggggacagagacgtacaa
gatgatcgatacaaggggagggcaggggaccgaggaagagacagagacagagacagggat
agggatagggatcgagatggtgacagaaatagagatagagatagagataggtacagggat
cgagataaggatagagataggcgcagggatagatatgaaagggatgagagacatggtggt
agggatcgtgatgatgatggtggtgatgattatcagagaagtggaaggccaagggatcgg
aataggagaaatgggtatgaagaaaatgaaggttacacaggggatacaagagatggtaat
ggcaatcggagagatgatagggacaagcatacacaaaatgggcgacacctccctgtcgat
cacgaacctgaattgtacaaggtctacaagggtagagtttctagagtgatggacacgggt
tgctttgtccagataaatgatttcagaggcaaggagggtctggttcacgtttctcagatg
gctactcgaaggattaccaatgccaaggatgttgtaaagcgagatcaagaggtttatgtc
aaggttatttcagtttcagggcaaaagttgagcctttctatgagggatgtggaccaacat
tctggaaaggatttgcttccgcttaagaaaaaggatgccgatgatggtcctagaatgaat
ccttcaaatacgaaggatgatggcccagtggttaggactggcctttctggaattaagatt
gtggaagatgatgttactattccttcacgcagacctttgaagagaatgagctcacctgag
agatgggaagccaaacaactgattgcttctggtgttttaagtgtaaacgactatccttca
tatgatgatgagggagatgggctattatatcaagaagagggtgctgaagaggagcttgag
attgagttgaatgaagacgagcctgaatttctgcaaggccagagtagatactcaattgac
atgtcgccagttaaaatattcaaaaatccggaagggtctctgagccgggcagctgcactt
caatctgcactgattaaggagcgtagggaagttcgtgagcagcagcaaaggaccatgctt
gattcaattccaaaggatcttaatcgaccttgggaagaccctatgccagagacaggtgag
aggcatcttgcacaggagctcaggggcgttggcttgtcggcctatgatatgcctgagtgg
aagaaggatgcttatggaaaagatattagtttcgggcagaaatcgaagctctctatccag
gaacagaggcaaagcttacccatttacaagctgaagaaagaacttattcaggccgttcat
gataatcaggtacttgttgtcattggtgagactggttcaggtaagacaacccaggtaact
cagtatcttgctgaagctggatacacaacctccggtaaaattgggtgcactcaaccacgt
agggtggctgcaatgtctgtcgcgaagagggttgctgaagagtttggatgtcgcttagga
gaggaagttgggtatgcaattcgttttgaggattgtactggacctgatactgtgatcaag
tatatgactgatggtatgcttcttagggagattttgattgatgataacttgtcacagtac
tcggtagttatgcttgatgaagctcacgagagaacaatcttcactgatgttctttttgga
ttgctgaagcaacttgtgaaaaggagacctgaccttcgactgattgtcacatctgctact
ttagatgccgaaaaattttcaggatatttctttaattgtaatatttttacaattcctggg
cgaactttccctgtggagatcctctatactaagcagccagaaactgattatcttgatgct
gctttaatcacagtcttgcagatccacttgacagagcctgaaggtgacatacttcttttc
ttgactggccaggaggagattgattttgcatgtcagtctctatacgagagaatgaaagga
ctcggtaaaaatgttcccgagttaataattctaccagtctacagtgccttgcccagtgaa
atgcagtccaggatttttgaaccagctcctcctggtaagaggaaagttgtagtggcgact
aacattgctgaggcttcattgacaatagatggaatcttttatgttattgatcctgggttt
gctaaacagaatgtatataacccaaagcaagggcttgattctcttgttatcacaccaatt
tcacaagcatcagccaaacaacgtgcggggcgtgctgggcgaacaggacctggaaaatgt
taccgcctctatactgagagtgcttatcgcaacgagatgtctcctacaacaataccagaa
atccagagaatcaatcttggtcatactactcttactatgaaagccatggggataaatgat
ctcctgtcatttgattttatggatccaccttcaccccaagcactaatttcagcaatggaa
caactttacagtctaggagcactggacgaagaaggacttctgactaagttgggtagaaaa
atggccgaatttcctttagatccacctttgtctaagatgctgctagctagtgtggatctt
ggatgcagtgatgagattttgaccataattgcaatgattcagactggaaatatcttttac
aggccaagggaaaaacaagcccaggctgatcagaaaagggccaagtttttccagccagag
ggagatcatctgactttgcttgcagtttatgaggcgtggaaagccaaaaacttttcaggc
ccttggtgttttgaaaactttgttcaatctcgatccttgaggagagcacaggatgtgagg
aaacaacttctttcaattatggacaagtacaaactggatgtggtgagtgcaggcaagaat
ttcacacagataaggaaggcaattacagcagggttctttttccacgcagccagaaaggat
cctcaagagggttatcgaacgctagtcgagaaccaaccggtttatatccatccaagcagc
gctttattccaaagacaacccgactgggtcatataccacgagctagtcatgacaacaaaa
gagtacatgcgtgaagtgacagtcatagatcccaaatggcttgttgaactagctccaaga
tacttcaaagttgcagacccaacaaagatgagtaagcgaaagcgacaagagcggattgaa
ccactctacgacaggtatcacgaacccaactcttggcgattgagtaagagacgagcttaa

DBGET integrated database retrieval system