KEGG   Cucurbita moschata (crookneck pumpkin): 111452490Help
Entry
111452490         CDS       T05248                                 

Definition
(RefSeq) fanconi-associated nuclease 1 homolog
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cmos03400]
    111452490
Enzymes [BR:cmos01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     111452490
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     111452490
DNA repair and recombination proteins [BR:cmos03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     111452490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC HIRAN
Motif
Other DBs
NCBI-GeneID: 111452490
NCBI-ProteinID: XP_022949023
Position
Unknown
AA seq 945 aa AA seqDB search
MLRGRESLVRLVGKRRRFLPNRLSLLSSPVENTLNLCSDEDCKPLPVVRTPDAHKDGDTE
TSSSGKYVTCPVCSSRVNGEDSIINSHLDACLSRGTKRKLTQSSLLQLNFYSRPKVQHHS
HVLKFEKNESSVSPDDGPVDIVHRLPKDASYNENDKIKCGSLEECAMQPQRDCLLDSLNN
SERTNGATEIYSPMNKGATSGMVTTNKDDLSGMILETFIVGRKFSDEKELNLGASISLER
DPTNVKDPNAIKVISEDSGCYKMLGFLPRELAKFLSPLIEKYCLSFKGFVTTAPRSSVDV
VPIEVMCDNINLLDEKNCDVEFKNLWTRIQQAIDSMKNFTPNALKYQKNFSLLIQEVLQG
YSHLLSDEENRFLDVFNSLSDDSQRLFIRLYMRKGPWFRMSSTSYKEVLDSRQAVKELSE
AGYLCCFDTNDADNTDMIQILNLLTVSELREVMCMLKKNCSSSMRKDDLVASLLAPYKDG
LCLPLPDLILGTIGICVRISSKAELLIWRAERLFFLNGEQDLSAFLLVDMGIVKYPTYSC
IISDQIFLDRNDLHAYEEAIEVAQLIDEALDEKDNKMVLRCVSVANSRVKPNQCTTSESV
PFFSFFTASWIYSKVLSLGVSFLERENRYNDAVLLLKRLLSCNTPDGRRGYWTLRLSIDL
EHLGYPSESLSVAENGLLDPWVRAGSRMALQRRILRLGKPPRRWKTPSFAESIKRKITEV
HVQGRPLNRETGMKSRFYGESGDQCSVEQLALEYYNGEGGGWLGVHSESGIWLTIFGLLM
WDVIFSDVPNVFRTKFQTAPLDFGTDSFYLLRQNSIESQLLKIQDGMGEEILITSWESHK
GTACSGVNWDRHSLAELRAAVTCIGGPCMASLCRHLAQDYRSWSSGMPDLLLWRFNSEYS
GEAKLVEVKGPRDRLSEQQRAWLLLLMDCGFITEICKITPMPKSA
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaggaagagaaagcttggtccgattggtagggaagcggagacgcttccttcct
aatcgtctttctctcctctcctctccagtcgagaacactttaaatctctgctctgatgaa
gattgcaagccccttcctgttgtgagaactccggatgctcataaagatggggacactgaa
accagtagctctgggaaatatgttacttgtccagtttgcagcagcagagtaaatggggaa
gactccattatcaactcccatctggatgcatgcttatctaggggaacgaagcggaaattg
acacagagctctcttcttcaattaaacttctattcccgaccaaaagttcaacatcattct
catgtgctgaaatttgagaaaaatgagtcttctgtgagtcccgatgatggtcctgtggac
attgtccatagattgcctaaagatgcatcttataatgaaaatgacaaaattaaatgcggt
tcgttagaagaatgtgcaatgcagccacaaagggactgtttactggatagcttaaataat
agtgaaagaactaatggtgctacagaaatttattctcccatgaataaaggagctacatct
gggatggttactaccaacaaggatgatttatctgggatgattcttgaaacttttattgtt
ggtcgtaagttcagtgatgaaaaggagttaaatcttggggcaagcatctctcttgaaaga
gatcccaccaatgtaaaggatcccaatgccatcaaggttatttctgaagattctggatgc
tacaagatgcttggatttctcccacgtgagttagctaagtttttgtctcccctaattgag
aagtattgcctaagctttaagggatttgtgacaactgctcccagaagttctgttgacgtt
gttcccatagaggtcatgtgtgacaacatcaatttacttgatgagaaaaattgtgatgtt
gagttcaaaaatttatggacaagaattcagcaagcaattgattcaatgaagaatttcaca
cctaatgcattgaaatatcagaagaacttttctcttttgatacaagaagttttacagggt
tactcccatttgttgtccgatgaagaaaatcgttttctagatgtattcaattcactatca
gatgatagtcagaggctctttatccggctttatatgcgtaaaggaccatggtttaggatg
tcttctacatcatataaagaagtattggattctagacaggcagtcaaagagctctcagaa
gcaggttatctatgttgctttgatacaaatgatgctgataacactgacatgatccagatt
ttgaatcttctcactgtctctgagctccgtgaagtcatgtgcatgcttaagaagaattgc
agtagcagcatgagaaaggatgatcttgttgcctctcttttggccccctacaaagatgga
ctgtgtctaccacttccagatctaattttgggcacaattggcatctgcgtcaggatatcc
tctaaagctgaattgcttatctggcgtgctgagaggcttttcttcctcaatggagagcag
gatttgtcagcctttctgcttgttgatatgggaatagtcaagtatccaacttacagctgc
ataatttcagaccagattttcttggatcgaaatgatttgcatgcttatgaagaggccatt
gaagttgcacaactaattgatgaagctcttgacgagaaggacaacaaaatggttttaaga
tgtgtatcagttgctaactcgcgtgtgaagccaaatcagtgtactacctctgaatcagtt
ccattcttttcattctttacagcatcatggatctattcaaaagtattgtctcttggagtt
tcctttctcgagcgtgagaataggtacaatgatgcagtgctactacttaagcgattgcta
agttgtaacactcctgatggaagaagaggatattggaccttgaggttgtcaattgatttg
gagcatttgggctatcccagcgagagcctgtcagtagctgaaaatggattgttagatcca
tgggttcgagctggttcaagaatggcattgcaaaggcgcatccttcgcttaggaaaacca
ccacgtcggtggaaaacccctagttttgctgagtctataaagaggaaaatcaccgaggta
cacgttcaagggcgaccattgaaccgtgaaacaggtatgaagagcaggttttatggagaa
agtggggatcaatgttcagttgagcagcttgcactcgagtattataatggggagggaggt
ggatggctaggtgttcattcagaaagtggcatttggttaaccatttttgggcttctcatg
tgggatgtcatattttccgatgtcccaaatgtttttcgtacaaaatttcagactgctccc
ctggattttggaacagatagcttttatttattgagacagaatagtatagagtcccaacta
ctgaaaattcaagatggcatgggcgaagagatcctcattacgtcgtgggaatcacacaag
ggaacagcatgtagcggagttaactgggaccgacactcactagccgagcttcgggcagct
gtgacatgcattggtggcccttgtatggcttcactctgtcggcatcttgcgcaagattat
cgaagttggtcgagtggaatgccagatttgttgctatggcgctttaacagtgagtacagt
ggtgaagctaaacttgttgaagtaaagggtcccagagacagactgtccgaacagcagagg
gcatggcttttgcttctaatggattgtggcttcattacagagatctgcaaaatcaccccc
atgcctaaatcagcttaa

DBGET integrated database retrieval system