KEGG   Cucurbita moschata (crookneck pumpkin): 111455345Help
Entry
111455345         CDS       T05248                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111455345
Enzymes [BR:cmos01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     111455345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox DAO EF-hand_1 Pyr_redox_3 EF-hand_6 EF-hand_5 EF-hand_7 NAD_binding_7 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 111455345
NCBI-ProteinID: XP_022952740
Position
Unknown
AA seq 574 aa AA seqDB search
MRFFSFFTRASRAFHSSPTYSKLLVISTLSSGGLLAYADSQSDASSPIEECPKKRVLVLG
TGWAGTSFLKDLDASKYDVQVVSPQNYFSFTPLLPSVTCGTVEARSIVEPVRNIVKKRKG
EVKFWEAECTKIDAANKKVFCRSLVDNNLVGNREFALEYDYLVIAMGAQVNTFNTPGVKE
NCHFLKEVQDAQKIRKSVIDCFEMAVIPSLSDEERRRNLHFVIVGGGPTGVEFAAELHDF
FKEDLVYLYPTVKDLVKISVIQSGDHILNAFDERISSFAEQKFQRDGIDVHTGCRVISVS
DKEIKMKVKSSGEVCSIPHGLIVWSTGIMTRPVVKDFMEQIGQGSRRILTTDEWLRVKGT
QNVYAIGDCATIDQRKIMKDIAAIFEAADKDNSGTLTVTEFQDVIDDILIRYPQVEIYLR
SKHLRDVKDLLKDSQGHEDEVDIEGFKSALSHADTQMKNLPATAQVAAQQGAYLSRCFNR
REQCTENPEGPRRFKSSGRYQFLPFRYKHLGQFAPLGGEQAAAELPGDWVSMGRSTQWLW
YSVYASKQVSWRTRYLVVSDWTRKFVFGRDSSGI
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgagatttttctccttcttcactagagcttcgagagcttttcatagctcccctacatac
tcaaagcttctggtcatcagcaccctcagtagcggaggtctattggcatatgcagattca
caatcagacgctagcagtcctattgaggagtgcccaaaaaagagagttctggtgcttgga
acaggatgggccggtaccagtttcctcaaggatctggatgcatcgaaatatgatgttcag
gttgtttcgcctcagaattatttctcatttactcctttattgcctagcgttacatgtgga
acagttgaagcacggagcattgtcgaacctgttcgaaacatcgtgaagaagagaaaaggt
gaagttaaattctgggaagctgaatgcactaagattgatgctgcaaacaaaaaggttttc
tgccggtcattagttgacaataacttggttggaaatagggagtttgctttagaatatgac
tatttggtaatagcaatgggagcgcaagttaatacttttaatactcctggtgtcaaggag
aactgccattttctcaaggaagtgcaagatgctcagaagatccgcaaaagtgtgatagat
tgctttgaaatggctgtgattcctagtctaagtgacgaagagcgaaggagaaatcttcat
ttcgttattgttggagggggtcccaccggggttgaatttgctgccgagcttcacgacttc
tttaaagaagatttggtttatttatatcctacggttaaagatctggtgaaaatttcagtg
attcaatcaggagatcacatcttgaatgcgtttgatgaaagaattagttcatttgccgaa
caaaaattccaaagagatggtattgatgtgcacacaggatgtcgagttatcagtgtatct
gataaggaaattaagatgaaggtgaaatcatctggagaagtctgttcaataccgcatgga
ttaattgtgtggtctacaggcatcatgactcgtcctgttgtgaaggatttcatggagcaa
attggccagggtagtagacgcattctaaccactgatgaatggcttcgagtgaagggcact
caaaatgtgtatgccattggtgattgtgctacaattgaccaacgcaaaattatgaaagat
attgccgccatatttgaagctgcagacaaagataactctggaaccctgacagttacagaa
tttcaagatgttatagatgatatcctcattaggtatcctcaagtagaaatatatttgagg
agcaaacatctacgtgatgtaaaagatctattgaaagattctcagggacatgaggacgaa
gtagatattgaaggatttaagtcggctctttctcatgctgacacgcagatgaaaaatcta
ccagctaccgcacaggttgctgcccaacaaggtgcgtatcttagcaggtgcttcaaccgt
agggagcagtgcactgagaaccctgaaggccctcgacgttttaagagttctggacgttat
cagtttcttcccttccggtacaagcacttgggacagttcgctcctttagggggagaacag
gccgctgcagaactccctggagactgggtttccatgggtcgcagcacccagtggctctgg
tattctgtatatgcaagcaagcaggtcagctggcgcacgaggtatttagtggtatcagac
tggacaaggaagtttgtatttggaagagactcgagcggcatctga

DBGET integrated database retrieval system