KEGG   Cucurbita moschata (crookneck pumpkin): 111458625Help
Entry
111458625         CDS       T05248                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00010  Glycolysis / Gluconeogenesis
cmos00562  Inositol phosphate metabolism
cmos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111458625
   00562 Inositol phosphate metabolism
    111458625
Enzymes [BR:cmos01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     111458625
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     111458625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 111458625
NCBI-ProteinID: XP_022957153
Position
Unknown
AA seq 490 aa AA seqDB search
MAGTKQIVMPMFLLVLLFLFTSSRAEQPPFSIKQHLSTVTRYSAANDGRNSNIAPAPDGC
VPIHLNLVARHGTRDPTKKRIRELNNLESQLDMLIRGAVGNDSSLRKAPSWFKGWKSPWR
GKVKGGELIPEGEEELYYLGIRTRKLFSDLFSDDYSSEVYTIKATQVPRASASAVAFGMG
LFSGRGSLGSDRRRAFSVISESRASDTMLRFFDCCQKYEDYRKNQEPAVDKLKEPVLDDI
TKSFTERYGLNFTRLHISSLWFLCKQEASLLNITNQACGLFSPSEVVLLEWTDDVELFIL
KGYGNSLNYKMGIPLLEDVIQSMKQAIKAKEEKLVLGSYEKARLRFAHAETVVPFTCLLG
LFLEGPDVGQTLREQPLQLPPQPPATRIWKGSTVAPFAGNNMLVLYSCPANLSDKYFVRV
LHNEEPITMPGCDNSDFCSFKVFMENIVAPHLEHDFDTLCTVDGEEPVLEPESSKLSLFH
WLFWLRNDNK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaacgaagcaaattgtaatgccgatgtttcttctagttttattgttcttgttc
accagttcgagagccgaacaaccaccgttcagtataaagcaacatctgtccactgttacc
aggtatagtgctgcaaatgatggtcgtaatagtaacattgctcccgctcctgatggatgt
gttccaattcatttaaatcttgtggctaggcatggaactcgtgatccaaccaaaaaacgg
atcagagagttaaacaacttggaaagtcaattagacatgcttataagaggtgctgtagga
aatgactcgtctctgcgtaaagctccttcctggtttaagggatggaaatctccttggaga
ggaaaagtgaagggtggagaattaattcctgaaggagaggaagaattgtattatcttggg
atccgaacaagaaaattgttttctgacttgttcagtgatgattatagctcagaagtatat
acaattaaagcaactcaggttcctcgggcatcagctagtgctgtggcatttggtatgggg
ctatttagtgggagaggaagccttggatcagatcgtcgtcgagctttttctgtcatcagt
gagagtcgtgccagtgatacgatgcttaggttttttgattgttgtcagaagtacgaggat
tataggaagaatcaggaacctgccgttgataaactcaaggaacctgtacttgatgatata
actaagtcattcactgaacgttatgggctaaattttacccggctgcacatttcatcactt
tggtttctctgtaagcaggaggcatcgttattgaacataacaaatcaagcttgtggactt
ttcagcccttccgaggttgttttgttggagtggacggatgatgtggagttgtttatattg
aagggttatggtaattcattaaactataaaatgggaattcctttgttggaagatgttatt
caatccatgaagcaagccatcaaggccaaagaagaaaagctagttcttggcagctatgag
aaggcaagacttcgttttgctcatgctgaaactgtagttccattcacatgtttgctcggg
cttttccttgaaggacctgatgttggacaaacactaagggagcagcctttgcaacttcct
ccacagcctccagctactagaatatggaagggaagcaccgttgcaccttttgctgggaat
aacatgctggttctctatagctgccctgctaacttgtcagataagtactttgtgcgagtt
ttgcataatgaagaacccataacaatgccgggttgtgacaattcggatttttgttccttc
aaagtgttcatggaaaacattgtggctcctcatcttgaacatgattttgacacattgtgc
actgtggatggggaagaacctgtgctggagcccgaatcaagtaagttatcactgttccat
tggctcttctggttgcgcaatgacaataaatga

DBGET integrated database retrieval system