KEGG   Cucurbita moschata (crookneck pumpkin): 111459236Help
Entry
111459236         CDS       T05248                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00071  Fatty acid degradation
cmos00592  alpha-Linolenic acid metabolism
cmos01040  Biosynthesis of unsaturated fatty acids
cmos01100  Metabolic pathways
cmos01110  Biosynthesis of secondary metabolites
cmos01212  Fatty acid metabolism
cmos04146  Peroxisome
Module
cmos_M00087  beta-Oxidation
cmos_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111459236
   00592 alpha-Linolenic acid metabolism
    111459236
   01040 Biosynthesis of unsaturated fatty acids
    111459236
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111459236
Enzymes [BR:cmos01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     111459236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 111459236
NCBI-ProteinID: XP_022957805
Position
Unknown
AA seq 663 aa AA seqDB search
MEGVDHLAHERNRSQFDVDAMKIVWAGSRHAFEVSDRMSRLVANDPAFRKDNRAQLPRKE
LFKNTLRKTAYAWKKIVELKLTEEEAARLRFFVDEPAYTDLHWGMFVPFVKGQGTEEQLQ
KWLPLAYKMKIIGCYAQTELGHGSNVQGLETTATFDPKTDEFVIHSPTLTSSKWWPGGLG
KVSTHAVVFARLITNGQDYGVHGFIVQIRSLEDHTVLPGITIGDIGMKFGNGAYNTMDNG
VMHFDHFRIPRNQLLMRFSQVTREGKYVQSDVPRQLVYGTMVYVRKTIVIDASNALSRAV
CIATRYSAVRRQFGSQNGVETQVIDYKTQQSRLFPLLASAYAFRFVGEWLEWLYTDVTQR
LGASDFSTLPEAHACTAGLKSVTTAATADAIEECRKLCGGHGYLCSSGLPELFAVYVPAC
TYEGDNVVLLLQVARFLVKTVSQLVSGKKPVGTTAYMGRLQHLMESSCKVQKAEDWLNPS
IVLEAFEARSAKMSVECAKRLSKFTNQEEGFQELSPNLVEAAVAHCQLIIVSKFIEKLKG
DIPGKGVKEQLQKLCSIYALYTLHKHMGDFLSTSTITPKQASLADDQLRSLYSQVRPNAV
ALVDAFNYTDHYLGSILGRYDGNVYPNLYNEAWKEPLNDSAVPDGYHEYIRPLLKQQLRN
ARL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgtcgatcatcttgcccatgagaggaacaggtcccaattcgacgtcgatgcg
atgaagatcgtatgggcgggttctcgtcatgcctttgaagtatctgatcgaatgtctcga
ttggttgctaatgacccagcctttcgaaaggataacagggctcaattacctaggaaggag
ctgttcaagaacacgctcagaaaaactgcttatgcatggaagaagatcgttgagcttaag
cttactgaggaggaagctgctagattaaggttctttgtggatgagccagcatatacagat
cttcactgggggatgtttgttccatttgtgaaagggcaaggaactgaggagcagctacag
aagtggttgccattggcttataaaatgaaaataattggttgctatgctcaaaccgaactc
ggtcatggttcgaatgttcaagggctcgaaacaactgcaacgtttgatccaaagactgat
gaatttgttattcatagtcctacactcacctcaagcaaatggtggcctggtggtttgggt
aaggtttcaacacatgctgttgtatttgctcgtcttatcacgaacggtcaagactatgga
gtgcacggtttcatagttcagataaggagtttggaagatcacacagttctacctggcata
accattggagacattggtatgaaatttgggaacggagcgtacaatactatggataatggg
gtcatgcattttgatcacttccgaatcccgaggaaccaactgttgatgaggttttctcaa
gttacaagggaagggaaatatgtgcaatcagatgttccacgacagctagtttatggcact
atggtatatgttagaaagacgattgtaattgatgcttcaaatgccttgtcacgtgccgtc
tgtattgctactaggtacagtgctgttcgtagacaatttggatcacagaatggtgtggaa
acccaggtgatcgattataaaacacagcaaagtaggctattccctttgctggcttctgcc
tatgcttttagatttgttggtgagtggttagaatggctatatacggatgtgactcaaaga
ctgggagccagcgatttctcgacactgcctgaggctcatgcatgcactgcagggttgaag
tcggtcacaacggctgcaactgctgatgcaattgaggagtgccggaagttgtgcggtggc
catggttacctttgtagcagtgggcttcccgagttgtttgcagtttatgtccctgcctgt
acttatgaaggagacaatgttgtgctactattgcaggttgcacgatttcttgtaaagacc
gtgtcccagttggtgtctgggaagaagcctgttggtacaacagcttacatgggacggcta
caacatctgatggaatcgtcttgcaaagttcagaaagctgaggactggttaaacccaagc
atcgttcttgaggcatttgaagcaaggtcagctaagatgtctgtggaatgtgccaaaaga
ctaagcaagttcaccaatcaagaagaaggttttcaggaactttctcctaatttagttgag
gctgcagttgcacattgccaattaattattgtttccaagttcatcgagaaacttaaggga
gacataccaggaaagggagtaaaagagcaactgcagaagctttgcagtatttatgctttg
tatacactacacaaacacatgggtgattttctttccacttccaccatcactcccaaacaa
gcttctcttgctgatgatcaacttagatctctatactcccaggttcggccaaatgcagtt
gctttagtcgatgcgtttaactacaccgaccattaccttggctcgatccttggtcgctat
gatgggaatgtttacccaaatctctacaatgaggcatggaaggaacctctaaatgactcc
gccgtgcctgatggctaccatgaatacattagaccattgcttaagcagcagcttagaaat
gcaaggctatga

DBGET integrated database retrieval system