KEGG   Cucurbita moschata (crookneck pumpkin): 111460795Help
Entry
111460795         CDS       T05248                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00020  Citrate cycle (TCA cycle)
cmos00640  Propanoate metabolism
cmos01100  Metabolic pathways
cmos01110  Biosynthesis of secondary metabolites
cmos01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111460795
   00640 Propanoate metabolism
    111460795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmos04147]
    111460795
Enzymes [BR:cmos01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     111460795
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     111460795
Exosome [BR:cmos04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111460795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 111460795
NCBI-ProteinID: XP_022959857
Position
Unknown
AA seq 421 aa AA seqDB search
MVRGLLNKLVSRSLSVAGKWQQQQLRRLNIHEYQGAELMNKYGINVPKGIAVSSVDEAKN
AVQTAFPDAKELVVKSQILAGGRGLGTFKSGLKGGVHIVKVDQVEDYAGKMLGQILVTKQ
TGPQGKVVSKVYLCEKLSLTNEMYFAITLDRITAGPLIIACRKGGTSIEDLAENFPDMII
KVPIDVFQGITDEDAAKVVDGLAPKTADRKDSIEQVKKLYKLFCECDCTLLEVNPMAETS
ENQLVAADAKLNFDDNAAFRQKAIFALRDPTQEDPREVDAAKADLNYIGLDGEIGCMVNG
AGLAMATMDIIKLHGGTPANFLDVGGNASEGQVVEAFKILTSDEKVKAILVNIFGGIMKC
DVIASGIVNAAKQVDLKVPVVVRLEGTNVDQGKRILKESGLTLITAEDLDDAAEKAVKAA
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggtgagagggttgctcaataagcttgtctctcgatctctttctgtcgcaggaaaatgg
cagcaacaacagctgcgccgtctcaatatccatgagtatcagggggctgagctgatgaac
aaatatgggatcaatgtacccaagggtattgctgtttcttctgttgatgaagcaaaaaac
gcagtgcaaactgcttttcccgatgcgaaagagttggtcgttaaaagtcaaattttggct
ggtggaagaggtttgggaacattcaagagcggcttaaagggtggagttcacattgtgaag
gtggatcaggttgaagattatgctggaaagatgcttggccagatacttgtcaccaaacaa
actggtccccagggcaaagttgtgagcaaggtttatctgtgtgagaagttgtcacttacc
aacgaaatgtactttgctatcactctggatcgtataactgctggcccacttataattgcc
tgtagaaagggtggaactagcatcgaagatcttgctgagaacttcccagatatgattata
aaggtacctattgatgttttccaaggaattacagatgaagatgctgcgaaggtcgtggat
ggtttggctcccaagactgctgatagaaaggattcaattgaacaagtgaagaaattgtat
aaactcttctgtgaatgtgactgtacgttactggaagtaaatcccatggcggagacttct
gaaaaccagctggtggctgctgatgctaagctaaacttcgatgataatgccgcattccgt
caaaaagcaatatttgctcttcgtgatccaactcaggaggatcctcgagaggttgatgct
gccaaagcagatctaaattacattggcttagacggagaaattggttgcatggtcaatggt
gcaggactagcaatggctacaatggatataattaagttgcatgggggaactcctgccaat
ttcctggatgtaggtggaaatgcttctgaagggcaggttgttgaggcatttaagatattg
acctctgatgagaaagtcaaagcaattttggtgaacatttttggtggaataatgaaatgt
gatgtcatagctagtggaattgtcaacgctgccaagcaggttgacctcaaagtgcccgtg
gttgttcggcttgaaggtacaaacgttgaccaaggaaaaagaattctgaaggaaagtggg
ttgacattgataacagcagaagatctggatgatgctgcagagaaagcagtgaaagccgca
tattga

DBGET integrated database retrieval system