KEGG   Cucurbita moschata (crookneck pumpkin): 111460997Help
Entry
111460997         CDS       T05248                                 

Definition
(RefSeq) alcohol dehydrogenase class-3-like
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00010  Glycolysis / Gluconeogenesis
cmos00071  Fatty acid degradation
cmos00350  Tyrosine metabolism
cmos01100  Metabolic pathways
cmos01110  Biosynthesis of secondary metabolites
cmos01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111460997
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111460997
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    111460997
Enzymes [BR:cmos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     111460997
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     111460997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N 2-Hacid_dh_C TrkA_N UDPG_MGDP_dh_N MinC_C AlaDh_PNT_C ADH_zinc_N_2 Reo_sigma1 PEP-CTERM
Motif
Other DBs
NCBI-GeneID: 111460997
NCBI-ProteinID: XP_022960184
Position
Unknown
AA seq 379 aa AA seqDB search
MATQGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRVKILYTALCHTDAYTWSGKDPE
GLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRAAT
GVGVMMSDRQSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPAAPLDKVCLLGCGVP
TGLGAVWNTAKVEPGSNVAIFGLGTVGLAVAEGAKAAGASRIIGIDIDSKKFEIAKKFGA
TEFVNPKEHDKPIQQVIVDLTDGGVDYSFECIGNVNVMRSALECCHKGWGQSVIVGVAAS
GQEISTRPFQLVTGRVWKGTAFGGFKSRSQVPWLVEKYLKKEIKVDEYITHELTLEEINK
AFDLMHGGDCLRCVLSAHP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggccactcaaggtcaagttatcacatgcaaagcggcggtggcctgggaacccaataag
ccattggtgatcgaggatgttcaggtggctccgccacaagctggcgaggtccgagtcaag
atcctctacactgctctttgtcacaccgatgcttatacttggagtggcaaggaccctgaa
ggtctcttcccctgtattctaggtcatgaggctgcagggattgtagagagtgttggtgaa
ggtgtgactgaagttcagcctggagatcatgtcattccttgctaccaagcagaatgtcga
gaatgcaagttttgcaaatcggggaaaactaacctttgtggcaaagttcgtgctgccacg
ggggtgggagtaatgatgtcagatcgtcagagtcgtttctctataaatggaaaacctata
tatcacttcatgggcacgtcaacatttagtcaatacactgttgttcacgatgttagtgtt
gcaaagattgaccccgcggctcctttggataaagtatgccttcttggatgtggtgttccc
acaggtcttggagctgtttggaacacagcaaaagtagagccagggtccaatgttgctatt
tttggcctggggactgtaggcctcgctgtggcagaaggtgccaaagcagctggtgcctca
cgtataatcggcattgatattgacagcaaaaagtttgaaattgctaagaaatttggagcg
actgaatttgtgaacccaaaggaacatgacaaaccaattcagcaggtcatcgttgatctc
acggatggcggtgttgactatagttttgagtgcatagggaatgtcaatgtgatgagatct
gctctggagtgctgccacaagggctgggggcaatcggtcattgtgggggtcgcagcatct
ggccaggaaatatccacgagacctttccagttagtgactggtcgtgtctggaaaggaaca
gcttttggtggtttcaaaagtcgttctcaagtgccttggcttgttgagaagtacttgaag
aaggaaatcaaagtcgacgaatacataacccacgagttgaccctggaggagatcaacaaa
gcctttgatctgatgcacggaggcgattgcctgcggtgcgttctttccgcccatccctaa

DBGET integrated database retrieval system