KEGG   Cucurbita moschata (crookneck pumpkin): 111461165Help
Entry
111461165         CDS       T05248                                 

Definition
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00450  Selenocompound metabolism
cmos00970  Aminoacyl-tRNA biosynthesis
cmos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    111461165
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111461165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmos01007]
    111461165
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmos03016]
    111461165
Enzymes [BR:cmos01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     111461165
Amino acid related enzymes [BR:cmos01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   111461165
Transfer RNA biogenesis [BR:cmos03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    111461165
 Prokaryotic type
   Other AARSs
    111461165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 111461165
NCBI-ProteinID: XP_022960433
Position
Unknown
AA seq 614 aa AA seqDB search
MAARINTSIQNSLWLLNPLQSSRNLKATHLRTRFNFYQNLLSAPSSCSSSSSKRAIFCSS
ASNFNSHDGGAATDPFVITTPLYYVNAAPHMGSAYTTIAADAIARFQRLLGKKVIFITGT
DEHGEKIATAAAAQGSGPSEHCDNISEAYKTLWKDLDIAYDKFIRTTDPKHETIVKEFYS
NVLANGDIYRADYEGLYCVNCEEYKDEKELLADNCCPIHLKPCASRKEDNYFFALSKYQR
LLEETLTQNPGFVQPAFRLNEVQSWIKSGLKDFSISRASVEWGIPVPNDQKQTIYVWFDA
LLGYISALSENDEQPNLQTAVASGWPASLHLIGKDILRFHAVYWPAMLMSAGLKLPKMVF
GHGFLTKDGMKMGKSLGNTLEPNELVQKFGSDPVRYFFLREVEFGSDGDYAEDRFINIVN
AHLANTIGNLLNRTLGLLKKNCQSTLVVDSSAAAVGNAFKEKVEELVAKARNHYEELSLS
SACEAVLEIGNAGNSYMDERAPWSLFKQGGASSDAAAKDLVLILEAMRIIAIALSPVTPR
LSWRIYEQLGYPEDQFAAATWNETKWGGLKAGQVMAPPNPVFARIEQAIVNGEEEAPKKP
VKSKKKIAQKVAEA
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggccgctagaataaacacctccatacaaaattctctctggctcttaaaccctttgcag
agttctcgcaatctcaaagctacccatttgagaacccgcttcaatttctatcaaaatctg
ttatcggccccgtcttcttgttcttcttcttcttcaaaacgagccatattctgttcctct
gcgagcaatttcaattcccacgatggcggagccgctacagacccgtttgtcatcacaaca
ccactttattatgttaatgctgcccctcatatggggagtgcttataccaccattgctgcc
gatgccattgcgcggtttcagaggctgctaggaaagaaagtcatcttcattactggcaca
gacgagcacggggagaagattgccacggctgctgctgctcagggttcgggtccaagcgaa
cattgtgataacatttcagaggcatacaagacactctggaaagatctagatatagcttat
gataagttcattcggacaactgatccaaaacacgagaccattgtaaaggaattttactcg
aacgttcttgccaacggagatatctatagagctgattatgagggactttattgtgtcaat
tgtgaggaatacaaggatgaaaaagaacttcttgctgacaactgttgtcctatacacctg
aagccctgtgcttcaaggaaagaagacaattacttttttgcattgtcaaaataccagaga
ttgcttgaagaaactttaacacagaatccggggtttgtgcagcctgccttccgtttgaac
gaggtgcaaagttggattaaaagtggcctaaaggacttctctatctccagagcatcagtt
gaatggggcattccagttcccaatgatcaaaagcaaaccatttatgtttggtttgatgca
ttattaggttatatatcagctctatcagagaacgacgagcaaccaaatttacaaacggcc
gttgcttcgggttggcctgcttctttacatttgattggtaaggatattttacgtttccat
gcagtttattggcctgctatgctaatgtctgctggactaaagcttccaaagatggttttt
ggtcatgggttcttgacgaaggatggtatgaagatgggcaagtcgttaggcaatactctt
gaaccaaatgaattggttcaaaagtttggctcggaccccgtgcgatacttcttccttcga
gaggtggaatttggtagtgatggagactatgctgaggatcgtttcatcaatattgtcaat
gcgcatcttgcaaatacaataggaaatcttcttaatcgaactctcggactccttaaaaag
aactgccaatctactttggtggttgattcgtctgctgcagctgtaggaaatgctttcaag
gaaaaagtcgaggaattggttgcgaaagctcggaatcattacgaagagctctccctatca
tcggcttgtgaggctgtgttggagattggcaatgctggaaattcctacatggatgagcga
gcaccatggtctctcttcaaacaagggggtgcctcatcagacgcagctgcaaaggacctt
gttcttatactcgaggcgatgcgaatcatagccattgcactatccccagtaacgccacgc
ttaagctggagaatatacgagcagcttggctaccctgaggaccagtttgcagctgcaaca
tggaatgagacgaaatggggagggctgaaggctggtcaggttatggctcctccaaaccca
gtctttgctaggattgaacaagccattgttaatggtgaagaagaagctcccaaaaaacca
gtcaaaagcaagaagaaaatagctcaaaaagtggcagaagcctaa

DBGET integrated database retrieval system