KEGG   Cucurbita moschata (crookneck pumpkin): 111461575Help
Entry
111461575         CDS       T05248                                 

Definition
(RefSeq) arginine--tRNA ligase, cytoplasmic-like isoform X1
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111461575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmos01007]
    111461575
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmos03016]
    111461575
   03029 Mitochondrial biogenesis [BR:cmos03029]
    111461575
Enzymes [BR:cmos01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     111461575
Amino acid related enzymes [BR:cmos01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   111461575
Transfer RNA biogenesis [BR:cmos03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    111461575
 Prokaryotic Type
   Other AARSs
    111461575
Mitochondrial biogenesis [BR:cmos03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    111461575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e Syd
Motif
Other DBs
NCBI-GeneID: 111461575
NCBI-ProteinID: XP_022960914
Position
Unknown
AA seq 644 aa AA seqDB search
MFALFLSPAPPSPLLSFNPFSHISPPSCIPAADLLRVASRRLISATKTTQSVSTMATEEE
NVGNMKRQLAKIFDVSLRATVPEETDVEPLVAACAGKFGDYQCNNAMGLWSKIKGKGSQF
KGPPSVGQAIMKNLPPSEIIESCSVAGPGFVNVLISKNWIAKSIQKMLIDGIETWSPRLP
IKRAVVDFSSPNIAKEMHVGHLRSTIIGDTLARMLEFSNVDVLRRNHVGDWGTQFGMLIE
FLFERFPNWEEVTETAIGDLQTFYKASKQRFDSDPAFKEKAQQAVVLLQGGEAKYRKAWA
QICEISRNEFNRVYERLGVQLEEKGESFYNPYIPNVIKELTDKGLVEESQGARVIFIDGI
NIPLIVVKSDGGFNYASTDLAAIWYRLNEEKAEWIIYVTDIGQQQHFDMVFRACKRAGWL
PLEDNKHPKATHVGFGLVLGEDGKRFRTRNTEVVRLVDLLDEAKSRSKAALIEREKAAEW
TEAELEQIAEAVGYGAVKYADLKNNRLTNYTFNFDQMLNDKGNTAVYLLYAHARICSIIR
KSGKDIEELKKTGTIVLEHEDERVLGLHLLQFSEVVEEACTNLLPNVLCEYLYNLSEIFT
KKFYSNCQVVGSPQETSRLLLCEATGTVMRKCFYLLGIVPVYKI
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctctcttcctatcgccggctccgccttctccattgctctctttcaatccattt
tctcacatttctcctccctcttgcattcctgctgctgacttactccgggtggcgtctagg
cgactcatttctgccacgaagacgacacaatcggtttccacaatggcaactgaggaagaa
aacgtcggtaatatgaagagacaattagctaaaatattcgacgtatcccttagagcgacg
gtccctgaggagacggatgttgagcctttggttgctgcttgtgctggaaaatttggcgac
tatcagtgcaataatgctatgggcctttggtctaaaataaaaggaaaaggaagtcagttc
aaaggccctccttccgttggacaggccattatgaaaaatcttcctccatctgaaatcata
gaatcatgttctgtggcaggccctggtttcgtgaatgttctaatatctaaaaattggatt
gctaagagcatacaaaaaatgctaattgatggtattgaaacttggtcaccgcggcttcca
attaaaagagcagtagttgatttctcctcgcctaatatagcaaaagaaatgcatgttggc
cacttaagatctacgatcattggagacactctagcccggatgcttgaattttcaaacgtt
gatgttcttcggagaaaccatgttggtgactggggaacacagtttggtatgttgatcgaa
ttcctttttgaaagatttcccaactgggaagaagttactgaaacagcaattggagatctg
cagacattctataaggcgtcaaagcagaggtttgatagtgatcctgcattcaaggagaag
gcacaacaggcagtggttcttcttcagggtggtgaagctaaatatcgcaaggcttgggca
caaatatgtgaaatcagcaggaatgaatttaatagggtgtacgaacgccttggagttcaa
ttagaggagaagggagagagcttttacaacccatacattcctaatgtcataaaagaactg
actgataagggcttagtggaagaaagtcagggtgctcgtgtaatctttattgatggaata
aatattcctctaattgttgtcaagagtgatggtggtttcaattatgcttcaactgatctt
gcagccatctggtatcgccttaatgaagaaaaagctgaatggattatatatgtcactgat
attgggcagcagcagcactttgacatggttttccgggcttgtaaacgtgctggctggctt
ccacttgaggataataagcatcctaaagcaacccatgttggttttggtttggttcttggt
gaagatggcaagcgttttcgtactcgaaatactgaagtggttcgtttagttgatttgctt
gatgaagccaagagccgcagtaaagctgcacttattgagagggagaaagctgcagaatgg
actgaagcagaacttgagcaaattgctgaagctgttggttatggtgctgttaaatatgct
gacctcaagaacaacaggttgaccaactatacgttcaatttcgatcagatgctcaatgat
aagggcaacactgctgtgtatttgctgtatgcccatgctcgtatctgttcaatcatcagg
aaatctggtaaagacatagaggagttaaaaaaaacgggaacaattgtgttggagcacgag
gacgagcgtgttttgggacttcatttgttacaattttccgaggtggtcgaggaagcttgc
accaatctgttgccgaatgtgttgtgtgaatacttgtacaacttatcggaaatatttacg
aaaaaattctactccaactgccaggtcgttgggtcgccccaagaaacgagcagactccta
ctttgtgaagctacaggcacagtgatgaggaaatgcttctatctcctcggaatagtacct
gtctacaaaatataa

DBGET integrated database retrieval system