KEGG   Cucurbita moschata (crookneck pumpkin): 111462056Help
Entry
111462056         CDS       T05248                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A-like
  KO
K03254  translation initiation factor 3 subunit A
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111462056
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cmos03012]
    111462056
Translation factors [BR:cmos03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    111462056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI UPF0139
Motif
Other DBs
NCBI-GeneID: 111462056
NCBI-ProteinID: XP_022961493
Position
Unknown
AA seq 967 aa AA seqDB search
MASFIKPENALKRAEELINVGQKQDALQALHDLITSKKYRAWQKPLERIMFKYVELCVDM
RKGRFAKDGLIQYRIVCQQVNVTSLEEVIKHFMHLSTEKAEQARSQAQALEEALDVDDLE
ADKRPEDLMLSYVSGEKGKDRSDRELVTPWFKFLWETYRTVLEILRNNSKLEALYAMTAH
RAFQFCKTYKRTTEFRRLCEIIRNHLANLNKYRDQRDRPDISTPETLQLYLDTRFEQLKV
ATELELWQEAFRSVEDIHGLMCMVKKTPKPSLMVVYYVKLTEIFWISKSNLYHACAWLKL
FSLQKSFNKNLSQKDLQLIASSVLLAALAVSPYDSKHGASHLELEHEKERNLRMANLIGF
NLDSKLESRDVLSRSNLLSELVSKGVLSCATQEVKDLYHLLEHEFFPLDLATKLQPLLNK
ISKLGGKLSSASSVPEVQLSQYVPALEKLATLRLLQQVSKVYQTMKIESLSQMIPFFDFS
AVEKISVDAVKQNFIAMKVDHSRNIVLFGTLGIESDGLRDHLAVLAESLNKARAMIYPPV
RKVSKTGEILPDLADIVDKEHKRLLARKSIIEKRKEEQERQLLEMEREEESRRLKLLKIT
EEAEQKRLAAEYEQRKNQRLRREMEERELEEAQALLQEAEKRVGKKKGSRKPVLDSEKMT
KQTLMQLALTEQLRERQEMEKKLQKLAKTMDYLERAKREEAATLIEAAFQQRLLEERMIH
ERDQQLEVELSKQRHEGDLKEKNRLARMLESKKIFQERVINLRQEEFSRRRVEREEQIRQ
IIHARKAEREAKRKKIFYVRREEERIRILREEEEARKREEAERRKREEAERKAKLDEIAE
KQRQRERELEEKERRRKEMLFGGGAPADAPSRPYVSPVSQPLESGAAAAPAAAAAPAPAK
YVPRFRRTESSSPNAPPPESDRWGSSRSDNRPSQPDSWRSDERRSAFGSSRSSWSSSRGP
NRGSSDR
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccttcataaagccagagaatgctttaaaacgagctgaagagctgataaatgtt
ggccagaagcaagatgccttgcaagcccttcacgatcttatcacttcaaagaaatatcga
gcatggcagaaacctcttgagaggattatgttcaagtatgttgagctctgtgtggacatg
aggaaaggaaggtttgcgaaggatggtttaattcaataccgtattgtttgccagcaagtc
aatgttacttctttagaggaagtaatcaagcactttatgcatctttccactgagaaggca
gagcaggctcgtagccaagctcaagctttagaagaagctctggatgttgatgatttggaa
gctgataaaaggccagaagatctgatgcttagttatgtcagtggtgagaagggaaaggat
agatctgatcgtgaacttgttaccccttggtttaaatttctgtgggagacatatcgtaca
gttcttgagatacttaggaataactcaaagttggaggcactttatgcgatgacagcccat
cgtgccttccagttctgtaagacgtataaaagaacaacagaatttcgcagattatgtgaa
attatcagaaatcatcttgctaatctcaacaagtatagagaccaaagagatcgtcctgac
atttctactccagagaccttgcaattgtaccttgacactagatttgaacaactgaaggtt
gccacagagcttgagctctggcaggaagcttttcgttcggtggaagatattcatggtttg
atgtgcatggtgaagaaaacacctaaaccatccttgatggttgtttattacgtcaaatta
acagagatattctggatatcgaagagcaatctttatcatgcctgtgcttggcttaaactt
ttctcccttcagaagagtttcaacaaaaatttaagccagaaggatttgcagctgatagct
tcatctgttcttttagcagctcttgctgtgtccccttatgactctaaacacggtgcttct
catttagaacttgaacatgagaaagagcggaatttgaggatggctaatcttatagggttc
aatttagactccaaacttgaaagtagagatgtgctttcaagatcgaatcttctttctgaa
ctggtgtctaagggagtcctgagctgcgcaactcaggaagttaaagatctctatcatctt
ttggagcatgaattcttccctcttgatcttgcaacaaaattgcaacctttactaaacaaa
atatcgaagcttggaggcaagctttcatcagcttcatctgtccctgaagtgcaattgtcc
cagtatgttccggctcttgaaaaacttgctaccctgaggttgcttcaacaggtctccaag
gtgtatcagactatgaaaattgagagtctatctcagatgatcccattttttgatttttcg
gccgtggagaaaatatcagttgatgcagttaaacaaaatttcattgccatgaaagttgat
cattcaaggaacattgtgttatttggcactttgggtattgaatcagatgggcttcgggac
cacctggctgttctcgccgaatccttaaacaaggcaagagctatgatctatcctccagtt
aggaaagtatcaaaaacaggtgagatactgcctgatttggcagatattgttgataaagaa
cacaagaggctgcttgctcggaaatcaataattgagaaaaggaaggaagagcaggaacga
caacttttggaaatggaacgtgaggaggaatcaaggaggttaaaattactgaagataact
gaagaggctgagcagaagcgcctagctgcagaatatgaacaaaggaaaaaccaacgcctg
cgtagggaaatggaagagcgagagcttgaagaagcacaggctttacttcaggaagctgaa
aagcgtgttggtaaaaagaagggaagcaggaagccggtccttgactctgaaaagatgacg
aaacaaactttaatgcaattggcccttacggaacaattaagggagaggcaggaaatggag
aagaaattgcaaaagctagccaaaactatggattatctagaaagggcaaaaagagaggag
gctgcaactttaattgaagctgcatttcagcaacgtttgctcgaagagcgaatgattcat
gaacgcgatcagcagctggaggttgagttaagcaagcaacgccacgaaggtgatctcaag
gagaagaatcgattggctagaatgttggagagtaagaaaattttccaagaaagagtcatt
aatcttcgccaagaggagttcagcagacgcagagttgagagagaagaacaaatcaggcaa
ataattcatgctcggaaagcagaaagggaggctaagaggaagaaaatcttttatgtaagg
cgtgaggaggagaggattcgaattttacgcgaagaggaggaagcacgcaaacgtgaagag
gccgagaggagaaagagggaagaggctgaacgcaaggctaaattggatgagattgctgag
aagcagagacagagggagcgagaactggaagaaaaggaaaggcggcggaaagaaatgctc
tttggtggtggggcaccagccgatgcaccttctagaccttatgtttctcctgtttctcaa
cctctggagtccggggctgctgctgctcctgctgctgccgccgccccagccccagcgaag
tatgtgcctaggtttcgacgtactgaaagctctagccctaatgcaccaccacctgaatct
gatcgatggggaagcagcaggtccgataatcgaccatctcaaccagatagctggcgcagt
gatgaacgcagatctgcttttggaagttcaaggtcgtcctggtcgtcatcccgaggtcct
aatcgtggtagctcggatcgctga

DBGET integrated database retrieval system