KEGG   Cucurbita moschata (crookneck pumpkin): 111464230Help
Entry
111464230         CDS       T05248                                 

Definition
(RefSeq) U-box domain-containing protein 51-like isoform X1
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Usp APH PAS_6
Motif
Other DBs
NCBI-GeneID: 111464230
NCBI-ProteinID: XP_022964091
Position
Unknown
AA seq 782 aa AA seqDB search
MAEDETNESVTATHTVIAINRDKNSQSAVKWAVEHLFNRKNSGDCILIHVRSQSLHPQDA
DTVPKEYRPPTDAELHQFFLPYRGFCARKGIVAKEIVIHDIDVPSALIHYINKHSISNIV
VGASSRNAFTRTFKHPDVSTCLLKSTPESCSVYVIARGKVHTKRLRKRYKSLTDGKEKPS
GTLHTDKSLSKIQNTKDKSRHRYSNSVDSLSSVSDFSGPLSFRSTGTSSSESLDFSSTSS
ESNSKSFVTSNTAASIESEMRKLRFELKGKMEMYESACKEALVARQKANELAQLKIKEAK
KFERGKSAEEVLTALSELEKQKNKAGTEAALMAQRLEELEIQKKRNIAENKARIEAEEKQ
KTINLFERTNICFKRYRIDEIEAATDHFNESNKIGEGGYGPVYHAFLDHTSVAIKMLSPE
RSHGQRQFQQEIEVLSRMRHPHMVLLMGACPEYGCLVYEYMENGSLEDRLFRKDDTPPIP
WKTRFRIAADIATALLFLHQMKPEPVVHRDLKPANILLDQNYVSKIGDVGLARLVPPSVA
DSVTQYHMTAAAGTFCYIDPEYQQTGMLGVKSDIYSFGVLLLQLITARSPMGLSYQVEEA
IEHGTFPQILDPTITDWPIQDTLGLAQLALKCCELRKRDRPDLGTVLLPELIRLKKLGLS
GIPPKRKLTAFGRAHGQRTSNSAPHFKGSENEINVGERWQRVTFSTSFWSQKDGIGSNTI
SQQEMENWSSKNNSGAEVSTIPLSGNPIVELRKRRHISERCWSCVSCVSPTTSGLKNPHS
FA
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagatgaaactaacgaatccgttaccgccacccacacggtgatcgccattaac
agggataagaacagtcaatccgcggtgaaatgggctgtggaacacctgttcaataggaag
aactccggcgattgcatcctcatccatgttcggagtcagagcttgcatccccaggatgcg
gatacggttcctaaggagtatcgtccaccgactgatgctgaattgcatcagttcttcctt
ccataccgaggattctgcgcacgaaaaggaatagttgcaaaggagattgtcatccatgac
attgatgttccaagtgcgcttattcactatatcaataaacactccattagcaacattgtt
gtgggtgcttccagccggaatgcttttacgaggacgttcaaacatccagatgtctcaaca
tgtttgctcaaatcaactccagaatcatgttctgtatatgtcatagctagagggaaagtt
catactaagagattgagaaagcgatacaagtcactaactgatgggaaagaaaaaccatcc
ggaactcttcatactgacaagtctctatcaaaaatacaaaacacgaaagataaaagcagg
catcgttatagcaacagtgttgattcactgtcaagcgttagtgacttttcagggcctctc
agtttcagatcaactggcacatcatcctctgagagcttagatttttcgtcaacctcctca
gagagtaattcaaagagctttgttacctctaacacagcagcttccatagaatctgagatg
agaaagttaaggtttgaactcaaagggaagatggaaatgtatgaatcagcttgcaaggaa
gctctagtagcaagacaaaaggcaaatgaactcgcacaattgaagataaaagaagcgaaa
aagttcgagcgaggtaaatctgcagaagaggttttaacagcattgtcagagcttgagaag
cagaaaaacaaggctgggacagaagcagctctaatggctcaaaggctggaagaattagag
atccagaaaaagcgaaatattgctgaaaacaaggctaggattgaggcggaggagaagcag
aaaacaattaatttatttgaacgcactaatatctgcttcaaacgatacagaattgacgag
atcgaagcagcaacagatcattttaatgagtcaaacaagattggtgaagggggttatgga
cctgtttaccatgcctttctcgatcatacttctgttgccattaagatgttgagcccagag
agatctcatgggcagagacaattccagcaagagattgaggttttaagccgcatgaggcat
ccacacatggttctccttatgggtgcctgcccagaatatggttgccttgtttatgaatat
atggaaaacgggagcttagaagaccgtcttttccgaaaagacgacactcctccaatccct
tggaaaactcgtttcaggatagctgctgacattgccactgcacttctcttccttcatcaa
atgaagccagaacctgtggtgcatcgtgatctcaaaccagcaaacattctcctagatcag
aactatgtgagcaaaataggcgatgtgggtttggccaggctagtcccgccgtcggttgct
gatagtgtcactcaatatcacatgacggctgcagctggaaccttctgttacatcgatcca
gaataccaacaaacaggaatgctaggtgtgaaatcagatatttactcatttggtgttctg
ctactccagctcatcactgcaaggtcaccaatgggtctttcatatcaggttgaggaggcc
attgaacacggcacattcccacagatacttgatcccacaattacagattggcccattcaa
gatactcttggactcgctcaattagccctgaagtgctgtgagctaaggaaaagagataga
cccgacctcggtaccgttctattacctgaactgatcaggctaaaaaaattgggattgagc
ggaataccaccaaagaggaagctcacagcttttgggagagcacatggtcaacgcacttct
aactcagctccacatttcaagggatcagaaaatgagatcaatgtaggagaaagatggcag
cgagtgacattcagtacgagtttttggagccagaaggatggtattggttcgaataccatt
tctcagcaggaaatggaaaattggagctcgaagaacaacagcggtgcagaagtctcaacc
ataccactgagtggaaacccaattgtagaactgaggaagcggcggcacatcagtgaacgc
tgttggtcatgtgtaagttgtgtttctcctactacttctgggttgaaaaacccacactca
tttgcgtaa

DBGET integrated database retrieval system