KEGG   Cucurbita moschata (crookneck pumpkin): 111464529Help
Entry
111464529         CDS       T05248                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos00970  Aminoacyl-tRNA biosynthesis
cmos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmos00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111464529
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cmos03029]
    111464529
Enzymes [BR:cmos01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     111464529
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     111464529
Mitochondrial biogenesis [BR:cmos03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    111464529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 111464529
NCBI-ProteinID: XP_022964528
Position
Unknown
AA seq 547 aa AA seqDB search
MAFVGLRCIRTQPFLLHPAALFTRRRRVLYFSVKSSQSQTATQEKQRPIAISPHFDKQII
DKISKDYEAIIGIETHVQLSTLTKAFCSCPYNYGVSPNTNICPICMGLPGALPVLNSKVI
EFAVKLGFALNCSLSFNSKFDRKQYFYPDLPKGYQISQFDIPIASGGFIDLDLPIEYGGG
HRRFGITRVHMEEDAGKLLHSESGSYSQVDLNRAGVPLLEIVSEPDMRTGIEAAEYAAEL
QRLVRYLGVGNGNMQEGSLRCDVNVSVRPIGQSQFGTKVEIKNLNSFSSMSRAIDFEISR
QVLLHSQGQSDQIVQETRLWEEGAQKTITMRKKEGLSDYRYFPEPDLPEVILTKEYVDNI
RDSLPELPEMKRRRYESMGLSMQDVLFLANDISVAEFFDATIARGAEVKLAANWIMGDIA
AYMKNEKLTINDIKLTPEELAELIASIKGGTISGKIGKEILFELLAKGGTVNGLIKEKDL
VQIADPAEIERMVEKVLAENPNQLEQYRGGKTKLQGFFAGQVMKASKGKANPGLLNKILL
EKLNAKS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgtaggattgagatgcattcggacccaacctttcttgcttcaccctgctgct
ttgttcactagaaggaggagagttttgtatttctctgtgaaatcctctcaatcccaaaca
gctactcaagaaaagcaaaggcctatagcaatttcaccccattttgataaacagattatt
gataaaatctccaaggactatgaagctattattggcattgaaacccatgttcagctctcc
actctcaccaaggccttctgcagctgcccttacaattatggtgtttcaccgaacacaaat
atctgccccatctgcatggggcttcctggtgccttgcctgttttgaactcaaaagtgatt
gagtttgcagtgaagttgggttttgcactaaactgcagtttgtctttcaactcaaagttt
gataggaaacagtacttttacccagatcttcccaagggctatcaaatatctcagtttgat
ataccaattgcgagtggcggtttcattgaccttgatcttcctattgagtatggtgggggg
cataggcggtttggtatcaccagggttcacatggaagaggatgctggaaagctacttcac
tctgaaagtggaagctactctcaggttgacttgaacagggcaggagtgcccttgcttgag
attgtttctgaacctgacatgagaactgggattgaagctgcagagtatgctgctgagtta
cagaggttggttcgatatttgggcgtaggtaatggaaacatgcaagaaggttcccttcgg
tgcgatgtgaatgtgtcggttcgacctattgggcagtcacagtttggaacaaaggtggag
ataaaaaacttgaactcattttcatccatgagcagagcaattgattttgaaatttcaaga
caagtgcttctccatagtcaaggccaaagtgatcaaattgtacaggaaaccagactatgg
gaagaaggcgctcagaaaacaattacaatgaggaaaaaggaaggactttctgattatcga
tattttccagaacccgatctccccgaagtcatcctcacaaaagaatatgttgataatatc
cgtgattctttgcctgaacttccagaaatgaagcgtagaagatatgagagtatgggcctg
agcatgcaggatgtgcttttcctggcaaacgacattagtgtggctgagttttttgatgca
actattgcaaggggggctgaagtgaagctggctgcaaactggataatgggtgatattgca
gcctacatgaaaaatgagaagctaactataaatgatatcaagctcactccagaagagctt
gctgaattgatagcttccataaaaggtggtaccattagtggaaagatcgggaaagagatc
cttttcgagttgctagctaaaggtggaactgtaaatgggctgattaaagagaaggatttg
gttcagatcgccgatccggccgagatagagagaatggtggagaaagtactagcagagaat
ccaaatcagctagaacagtaccgtggtggcaaaaccaagctgcaaggcttttttgctggc
caggtgatgaaagcatccaaaggtaaagcaaatccagggcttctaaacaagattctcttg
gagaaactaaacgccaaaagctga

DBGET integrated database retrieval system