KEGG   Chamaesiphon minutus: Cha6605_3679Help
Entry
Cha6605_3679      CDS       T02414                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00020  Citrate cycle (TCA cycle)
cmp00640  Propanoate metabolism
cmp00660  C5-Branched dibasic acid metabolism
cmp01100  Metabolic pathways
cmp01110  Biosynthesis of secondary metabolites
cmp01120  Microbial metabolism in diverse environments
cmp01130  Biosynthesis of antibiotics
cmp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cha6605_3679
   00640 Propanoate metabolism
    Cha6605_3679
   00660 C5-Branched dibasic acid metabolism
    Cha6605_3679
Enzymes [BR:cmp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cha6605_3679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AFY94658
UniProt: K9UJ15
Position
complement(3871070..3872179)
Genome map
AA seq 369 aa AA seqDB search
MDLLEYQAKELFRDVGIPVLPSQRIDRPGDLKALRIPYPVVLKSQVSVGNRGKAGGIRFV
ENTIDAIAAARTIFNLPILGEYPNVLLAEAKYNTSQEFYLAIVIDRLACRPVLLGSTDGG
MNVNTILDRIHQVVVYEEFSSFYARQLALKMGLKGEIMLAVSEIIEKMYLLMRSQDLDLV
EINPLGVDRDGAVMALDGKISVNHHAVGRHPNLQPWQMVDVARNRLGTLSPLFNEVGNIG
ILCSGNGLALAMLDGIAQGGGQVAQCIVVDPACTEEIQIALDRIGVNVNSGSEGAESPSI
DVLLVNFVGSEIDSCQQVMQYLARDPHMTIIWRVLEPDLDRLAGFLPLSIKLVTNFDRAI
AQTLKLAKQ
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggatttattagagtaccaagctaaagaattgttccgagatgtcggcattccggtattg
ccatcccagcggatcgatcgaccgggggatcttaaggcattgcggattccttatccggta
gtattaaaatcgcaagttagcgttggcaatcggggcaaagctggggggattagatttgtc
gagaataccattgatgcgatcgcggcagcccggacgatcttcaatttgccaattttgggg
gaatatcccaatgtgctgttagcagaggcgaaatataataccagtcaggagttttatctg
gcgatcgtgatcgacagattagcctgtcgtccggtattgctcggctcgacagatggcggg
atgaacgttaataccattctcgatcgcattcatcaggtagtcgtatatgaagagttttcc
tctttttacgcgcgtcagctcgcgttgaaaatgggacttaaaggcgaaatcatgttggca
gtgagtgagattatcgagaagatgtaccttttgatgcgatcgcaagatttagatttggtc
gaaatcaatcctttgggggtcgatcgagatggtgcggtgatggcattagatggcaaaatt
agtgtcaaccatcatgctgtcggcagacatccaaatcttcaaccctggcagatggtagat
gtcgcgcgcaatcgtttgggtactttatcgccgctatttaatgaagtcggaaatatcggc
attctgtgtagtggcaatggtttagccctagccatgttagatggtatcgcccaaggtggg
ggtcaagtggctcaatgtatcgtcgtcgatcccgcctgtactgaagaaatccagatcgca
ctcgatcgcattggcgtgaatgtcaatagcggtagcgagggagccgaatcgccgtctatc
gatgttttactggtaaattttgtcggtagtgagatcgatagttgccaacaagtgatgcaa
tatctggcacgcgatccccacatgacgattatctggcgagtattagaaccagacctcgat
cgactcgcaggattcctgccattatctattaaactggtcactaatttcgatcgcgcgatc
gcacagactttgaagctggctaaacagtga

DBGET integrated database retrieval system