KEGG   Chamaesiphon minutus: Cha6605_4456Help
Entry
Cha6605_4456      CDS       T02414                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cmp  Chamaesiphon minutus
Brite
KEGG Orthology (KO) [BR:cmp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Cha6605_4456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AFY95387
UniProt: K9UJX5
Position
complement(4732089..4733345)
Genome map
AA seq 418 aa AA seqDB search
MLFIGFVCCLAVYVACNLGANDVANSMGTSVGSKAITLNQAIVIAGILEFTGAVLFGRQV
SSTLAISIANPDLFVSQPQTLLLGMIAVLISCGLWLQIATTKNLPVASSHAVVGAIAGFS
WVAAGTSAVQWSALGTISLAWVVTPVLSATVAAGLYSIIKRWILERERPLLQLQQWMPWL
SLILVSVFGVIVLPTVVATLPSAFLPEVPRHDFGLGLGGAAALAITLVGWRRLGAEKVDL
DSMTNPQTTEVVERQLARFQLLSACCVAFAHGSNDVGNAIAPLATILYIQSTGTVPQSSL
EIPLWVLVLGGVGIVTGLAIWGKQVIATIGEGIIKLEPSSGFAAELATAATILIASSYGL
PVSTSHALVGAVVGVGLVKNWQSVRLDTLKSIGLAWIVTIPIATILSAAIFSGLRYFF
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgttatttattggatttgtttgctgtttggccgtttatgtagcctgcaatctaggcgcg
aatgatgttgctaactcgatggggacttcggttggttccaaagcaattacactcaatcaa
gcgatcgtcattgctggcatcctcgaatttactggggcagtcttgttcgggcgacaagtt
tcttcaactttagcaattagtattgccaatcccgatttatttgtctcccagccacagaca
ttattgttggggatgattgccgtcttaataagctgtgggttgtggttgcaaattgcgact
accaaaaatttacctgtcgcttcttctcatgcggtcgttggcgcgatcgcgggatttagt
tgggttgccgctgggacgagtgcggtacaatggtcggcactgggcacgatttcgctggca
tgggtagttacacccgtactcagtgcgacggtagctgcgggcttgtattcaattattaaa
cggtggattttagaacgcgagcgaccgttgttacagctccaacaatggatgccgtggttg
tcgctaattttggtgagtgtatttggggtaattgttttaccgaccgtggtcgcaacatta
ccgtcggcatttttacctgaagtcccccgccacgattttggattaggattgggcggggcg
gcggcgttagcgattacgttggtaggttggcgcagattgggtgcggagaaggtcgatctc
gactcgatgacaaatcctcagacaaccgaagttgtcgagcgtcagttagccagatttcaa
ctacttagtgcttgttgtgtggctttcgctcacggttctaatgatgtgggcaatgcaatc
gcaccgttggcaacaattttatatattcaaagtacggggactgtcccccaatctagttta
gaaatcccgctgtgggtgctagtgctaggcggagtcggaatcgtgactgggttggcaatc
tggggcaaacaggtgattgcgactatcggtgaaggaattatcaaactcgaacctagtagt
gggtttgctgccgagctagccaccgctgcaacgatattaattgcttcgagttatggtttg
cctgtctcgacttctcatgctttggttggtgcggtagtgggggtcggtttggtcaagaat
tggcagtcggttaggttggacacgctcaaatcgatcggtttagcttggatagtgactatt
ccgatcgctacgatccttagtgcggctatattttcgggtttgcgttactttttctag

DBGET integrated database retrieval system