KEGG   Chamaesiphon minutus: Cha6605_5282Help
Entry
Cha6605_5282      CDS       T02414                                 

Definition
(GenBank) photosystem II DI subunit, Q(B) protein
  KO
K02703  photosystem II P680 reaction center D1 protein [EC:1.10.3.9]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00195  Photosynthesis
cmp01100  Metabolic pathways
Module
cmp_M00161  Photosystem II
cmp_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cmp00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    Cha6605_5282
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:cmp00194]
    Cha6605_5282
Enzymes [BR:cmp01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.9  photosystem II
     Cha6605_5282
Photosynthesis proteins [BR:cmp00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    Cha6605_5282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Photo_RC
Motif
Other DBs
NCBI-ProteinID: AFY96170
UniProt: K9UMX2
Position
complement(5580808..5582082)
Genome map
AA seq 424 aa AA seqDB search
MSPEIQLSSLCVQKMTRSPVITKPDDSHKVYKPEKGLQTLTIELNYVHTSKTFRSTRNTS
NHKTMTTTLQRTQNANVWDRFCSWITSTENRIYVGWFGVLMVPTLLSATICFIIAFIAAP
PVDIDGIREPVAGSLMFGNNIISGAVIPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVV
FHFLIGIFCYMGREWELSYRLGMRPWICVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGI
SGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEVESQNYG
YKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWFTSLGVSTMAFN
LNGFNFNQSVVDSQGRGINTWADIINRANLGMEVMHERNAHNFPLDLAAGEATPVALTAP
AING
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccagaaattcaactcagctcgctatgtgtgcaaaagatgactcgatccccagtc
ataaccaaacctgatgactcccataaggtctacaaacctgagaaaggtttacaaacgtta
acaatcgagttaaattatgtacatacatcaaaaacattccgttccaccaggaacacaagc
aatcataaaaccatgaccacaaccttacaacgcacccagaacgcgaacgtctgggatcgc
ttctgtagttggattacctccaccgagaaccgcatctacgtcggttggttcggcgtcctg
atggtaccaaccctcctctccgcaacaatctgcttcatcatcgccttcatcgccgctcct
ccagtagacatcgacggtattcgcgaaccagtagcaggttccttaatgttcggcaacaac
atcatctccggtgctgttattccttcctccaacgctatcggtcttcacttctaccccatc
tgggaagcagcttccttagatgaatggctatacaacggcggtccttaccaactagtagta
ttccacttcttaatcggtatcttctgctacatgggtcgtgaatgggaactctcctaccgc
ctcggtatgcgtccttggatctgcgtcgcttactccgctcccgtagcagcagcaaccgca
gtattcttaatctaccccatcggtcaaggttctttctctgacggtatgcctttgggtatc
tccggtacgttcaacttcatgatcgtattccaagctgagcacaacatcttaatgcacccc
ttccacatgttgggtgtagctggtgtcttcggtggtagcttgttctccgctatgcacggt
tccttggtaacttcttccttagttcgtgaaacaactgaagttgaaagccaaaactatggt
tacaaattcggacaagaagaagaaacttacaacatcgttgcagctcacggctacttcggt
cgtttaatcttccaatacgcttctttcaacaactcccgttccttgcacttcttcttgggt
gcatggcctgtagttggaatctggttcacttccttgggcgtaagcaccatggcgttcaac
ctcaacggtttcaacttcaaccaatctgtagttgactcacaaggtcgtggcatcaacact
tgggcagacatcatcaaccgcgctaacttgggtatggaagtaatgcacgagcgtaatgct
cacaacttcccgctcgacttggctgctggtgaagctactcctgttgctttgactgctcct
gctatcaacggttaa

DBGET integrated database retrieval system