KEGG   Chamaesiphon minutus: Cha6605_5414Help
Entry
Cha6605_5414      CDS       T02414                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00790  Folate biosynthesis
cmp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cha6605_5414
Enzymes [BR:cmp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cha6605_5414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AFY96301
UniProt: K9UPH3
Position
complement(5720678..5721373)
Genome map
AA seq 231 aa AA seqDB search
MTISSPQGSNSTGNERVGKIDSRPDRNTHNGEPVKIHDPEEVSLEDMMASVRQIILGVGE
DPEREGLLKTPKRVAESMRFLTSGYNQSLEDIINGAIFDEGHNEMVLVRDINFFSMCEHH
MLPFMGRAHVAYIPNQKVVGLSKLARIVDMYSRRMQVQERLTRQVAEALQAVLEPKGVAV
VMEASHMCMVMRGVQKPGSWTVTSAMLGVFQEDQRTREEFLNLIRHQPGAF
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgactatttcatctccccaaggtagtaattccactggcaacgagcgggttggtaagatt
gattctagacccgatcgcaatacccacaacggtgagccagttaaaattcacgatcctgaa
gaagtgagcctcgaagatatgatggcttcggtaaggcagattatcctcggagtaggcgaa
gatccagaacgcgaagggttgctcaaaactcccaaacgagtcgctgaatcgatgcgattt
ctgactagtggctacaatcagtctttagaagacatcatcaatggtgccatttttgatgaa
ggtcacaatgagatggtcttggttcgtgatatcaacttttttagcatgtgcgaacaccac
atgttacccttcatgggcagggcgcatgttgcatacattcctaaccaaaaagtcgtcggt
ttgagcaagctcgcccgcattgtggacatgtattcccgccggatgcaagttcaagaaaga
ctcacccgtcaagtcgcagaagcactccaagcagtgttagaacccaaaggtgtggcggta
gtaatggaagccagccacatgtgtatggtgatgcgtggtgtccaaaaacctggttcttgg
acggttactagtgccatgttaggtgtattccaagaagatcaacgcaccagagaagaattt
ctcaatctgattcgccatcagccaggagcattttag

DBGET integrated database retrieval system