KEGG   Chamaesiphon minutus: Cha6605_5810Help
Entry
Cha6605_5810      CDS       T02414                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
cmp  Chamaesiphon minutus
Pathway
cmp00230  Purine metabolism
cmp00240  Pyrimidine metabolism
cmp01100  Metabolic pathways
cmp01110  Biosynthesis of secondary metabolites
cmp01130  Biosynthesis of antibiotics
Module
cmp_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
cmp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
cmp_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:cmp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Cha6605_5810
   00240 Pyrimidine metabolism
    Cha6605_5810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cmp04131]
    Cha6605_5810
Enzymes [BR:cmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Cha6605_5810
Membrane trafficking [BR:cmp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Cha6605_5810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AFY96663
UniProt: K9UPP3
Position
6131466..6131915
Genome map
AA seq 149 aa AA seqDB search
MERTFIAIKPDGVQRGLVGEIIRRLETKGFTLVALKLLHPSRELAEQHYAVHKERPFFSG
LVDFITSGPVVAMVWQGEGVVAASRLTIGATNPLVSPPGTIRGDLGINIGRNLIHGSDAV
ETAQSEIALWFKEEELVSWSPTVSPWLSE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtggaacggacatttattgcgattaagcccgacggggttcaacgtgggttggttggtgaa
atcattcgtcgtctagaaacaaaaggctttaccctcgttgccttaaaattattgcacccc
agccgcgaattagccgaacagcactatgcagttcacaaagaaagaccttttttcagcggt
ttagttgattttattacgagcgggccagtagtcgcaatggtctggcaaggcgagggcgtc
gtcgctgcatcccgactgacgatcggtgcgaccaatcctttagtatctcctccaggaacg
attcgcggcgatctcggtatcaatatcggacgcaacctgattcatggttccgatgcagtg
gaaaccgctcaaagcgagatcgcactgtggtttaaggaagaagaattagtcagttggtcg
cctacagtttcgccttggttgtcagagtaa

DBGET integrated database retrieval system