KEGG   Corynebacterium marinum: B840_03515Help
Entry
B840_03515        CDS       T03633                                 

Gene name
metG
Definition
(GenBank) Methionine-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cmq  Corynebacterium marinum
Pathway
cmq00450  Selenocompound metabolism
cmq00970  Aminoacyl-tRNA biosynthesis
cmq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    B840_03515 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B840_03515 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmq01007]
    B840_03515 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmq03016]
    B840_03515 (metG)
Enzymes [BR:cmq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     B840_03515 (metG)
Amino acid related enzymes [BR:cmq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   B840_03515 (metG)
Transfer RNA biogenesis [BR:cmq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    B840_03515 (metG)
 Prokaryotic type
   Other AARSs
    B840_03515 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AJK68324
UniProt: A0A0B6TQ27
Position
709590..711419
Genome map
AA seq 609 aa AA seqDB search
MTQSVLVSVAWPYANGPRHIGHVAGFGVPSDVFARYQRMIGSEVLMISGTDEHGTPLLVQ
ADKEGVTVKELADRYNRQIVEDLAGLGLSYDLFTRTTTRNHYAVVQELFTGLYENGYMIR
ETTMGAVSPSTGRTLPDRYIEGTCPICGADGARGDQCDNCGNQLDPADLINPVSKVNGET
PKFVETEHFLLDLPSLAGALGEWLRGREDWRPNVLKFSLNLLEDLRPRAMTRDIDWGVPI
PVDGWADNNAKKLYVWFDAVIGYLSASIEWAWRSGNPDAWKQWWQDPEAAGFYFMGKDNI
TFHSQIWPAELIGYAGKGSKGGELHKYGEINLPTEVVSSEFLTMSGSKFSSSKGVVIYVK
DFLAEFGPDPLRYFIAVAGPENTDTDFTWDEFVRRVNNELANGWGNLVNRTVSMAHKNFG
AVPAPAELTDSDLRILDLAATTFDIVGDNLAQSKFKNGITAAMHVVGEANAYIAEQEPWK
LAKDESQRERLATVLWTALQVVSDCNVLLTPYLPHIAQRVHETLGRDGVWAAKPEIHEVA
DDMPVELVGVGLPEEGQTYPVITGNYSAQQAVWKRIDVVPGTPLAKPAPLIQKLDPELAE
TGPEWAPVQ
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtctgtgcttgtctccgtcgcctggccgtatgcgaacggcccccgccacatc
ggacacgtcgccggtttcggcgtcccctccgacgtcttcgcccgctaccagcggatgatc
ggcagcgaggtcctcatgatctcgggcacggatgaacacggcacaccgctgctggtgcag
gcggacaaggagggcgtgacggtcaaggagctcgccgaccgctacaaccgccagatcgtg
gaggacctcgccgggctcggcctgtcctacgacctgttcacccgcaccaccacccgcaac
cattacgcggtggtgcaggagctgttcaccggcctgtacgagaacggctacatgatcagg
gagaccacgatgggcgcggtctccccgtcgaccggccgcaccctgccggaccgctacatc
gagggcacctgcccgatctgcggcgccgacggcgcgcgcggcgaccagtgcgacaactgc
ggcaaccagctcgacccggccgacctgatcaacccggtctccaaggtcaacggggaaacc
ccgaagttcgtcgagacggagcatttcctcctcgacctgccctccctggccggcgcgctg
ggggagtggctgcgcggccgcgaggactggcgccccaacgtgctgaagttctccctcaac
ctgctcgaggacctgcgcccgcgcgccatgacccgcgacatcgactggggcgtcccgatc
ccggtcgacggctgggcagacaacaacgccaagaagctctacgtgtggttcgacgccgtg
atcggctacctctccgcctccatcgagtgggcgtggcgctccggaaacccggacgcgtgg
aagcagtggtggcaggaccccgaggccgccggcttctacttcatgggcaaggacaacatc
accttccattcccagatctggcctgccgagctcatcgggtacgccggcaagggatcgaag
gggggcgagctccacaagtacggcgagatcaacctgccgacagaggtcgtgtcctcggag
ttcctcaccatgtcgggctcgaagttctcctcgtccaaaggcgtggtcatctacgtcaag
gattttctcgccgagttcggcccggatccgctgcgctacttcatcgccgtcgccggcccg
gagaacaccgacaccgacttcacctgggacgagttcgtccgccgggtgaacaacgagctc
gccaacggctgggggaacctggtcaaccgcacggtgtccatggcgcacaagaatttcggc
gcggtccccgccccggccgaactcaccgactccgatctgcggatcctcgatctggcggcc
accaccttcgacatcgtcggggacaacctggcgcagtcgaagttcaagaacggcatcacc
gccgccatgcacgtggtcggcgaggccaacgcctacatcgccgagcaggagccgtggaag
ctggctaaggacgagtcccagcgcgagcgtctggccaccgtcctgtggaccgcgctgcag
gtcgtctccgactgcaacgtgctgctcaccccgtacctgccccatatcgcccagcgggtg
cacgagactctcggccgcgacggtgtctgggccgcgaagcccgagatccacgaagtcgcc
gacgacatgccggtcgaactcgtcggcgtcggcctgcccgaggagggccagacctacccg
gtgatcaccggcaactactccgcccagcaggcggtgtggaagcgtatcgacgtcgtgccc
ggcaccccgctggccaagcccgccccgctgatccagaagctggacccggagctggcggag
accggcccggagtgggcgcccgtccagtaa

DBGET integrated database retrieval system