KEGG   Corynebacterium marinum: B840_06575Help
Entry
B840_06575        CDS       T03633                                 

Gene name
zwf
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cmq  Corynebacterium marinum
Pathway
cmq00030  Pentose phosphate pathway
cmq00480  Glutathione metabolism
cmq01100  Metabolic pathways
cmq01110  Biosynthesis of secondary metabolites
cmq01120  Microbial metabolism in diverse environments
cmq01200  Carbon metabolism
Module
cmq_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cmq_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B840_06575 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B840_06575 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmq04147]
    B840_06575 (zwf)
Enzymes [BR:cmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     B840_06575 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     B840_06575 (zwf)
Exosome [BR:cmq04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   B840_06575 (zwf)
  Exosomal proteins of colorectal cancer cells
   B840_06575 (zwf)
  Exosomal proteins of bladder cancer cells
   B840_06575 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AJK68920
UniProt: A0A0B6TTM3
Position
1355624..1357168
Genome map
AA seq 514 aa AA seqDB search
MPLPVTDADAWVNPLRSTEDKRLPRIAGPSGMVIFGVTGDLARKKLLPAVYDLANRGLLP
AGFTLIGFGRREWSKPDFEDYVREAVEAGARTKFREHVWERLAEGMHFVEGNFDNEGFDQ
LAGTLAEMDSTRGTAGNWAFYLSVPPDYFSDVCHQLERSGLAEADGNSWRRVIIEKPFGH
DQATARELNRVVNAVFPEESVFRIDHYLGKETVQNILALRFANQLFDPLWNAHYVDHVQI
TMAEDIGLGGRAGYYDGIGAARDVIQNHLIQLLALVAMEEPVAFDPTELQAEKVKVLRAT
NPVYPLNRTTARGQYAAGWQGSHKVKGLRQEEGFDPLSTTETYAACTLEINSRRWAGVPF
YLRTGKRLGRRVTEIALVFKEAPHQPFLEGQTSSLGQNAIVIRVQPDEGVLMRFGSKVPG
SAMEVRDVNMDFSYSEAFTEESPEAYERLILDALLDESSLFPTNEEVELSWAILDPILAY
WAENGQPEEYESGTWGPAGADRMLQRSGRSWRRP
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcccgtgaccgacgccgacgcctgggtcaaccccctccgcagcaccgaggac
aaacggctgccccgcatcgccggtccctccggcatggtgatcttcggcgtcaccggtgac
ctggcccgcaagaaactgctgccggccgtgtacgacctggccaaccgcggtctcctgccc
gccggattcacgctcatcggtttcggccggcgggagtggagcaagcccgacttcgaggac
tacgtgcgcgaagcggtcgaggcgggggcgcgcaccaagttccgggagcacgtgtgggag
cggctcgcggagggcatgcacttcgtcgaaggcaacttcgacaacgaaggcttcgaccaa
ctcgccgggaccctggcggagatggactcgacccggggcaccgccggcaactgggccttc
tacctctccgtcccgccggactacttctccgacgtctgccaccagctcgagcgttcgggg
ctggcggaggcggacgggaactcctggcggcgggtgatcatcgagaagcccttcggccac
gaccaggccaccgcccgcgaactcaaccgcgtggtcaacgccgtcttcccggaggagtcg
gtgttccgcatcgaccactacctcggcaaggagacggtgcagaacattctcgccctgcgc
ttcgccaaccagctcttcgatcccctgtggaacgcccactacgtcgaccacgtgcagatc
accatggccgaggacatcggcctcggcgggcgggcggggtactacgacggcatcggcgcg
gcccgcgacgtcatccagaaccacctcatccagctgctggcactggtcgccatggaggag
cccgtcgccttcgacccgaccgaactccaggccgagaaggtcaaggtcctgcgcgcaacc
aacccggtgtacccgctcaaccgcacgacggcgcgcggccagtacgccgccggttggcag
ggctcgcacaaggtcaagggcctgcggcaggaggagggtttcgaccccctgtcgaccacc
gaaacctatgcggcgtgcaccctggagatcaactcccgccgctgggcgggcgtgccgttc
tacctgcgcaccggcaagcgcctcgggcggcgcgtcaccgaaatcgccctcgtcttcaag
gaggctccgcaccagcccttcctcgaggggcagacgtcctcgctggggcagaacgcgatc
gtcatccgcgtgcagccggacgagggcgtgctcatgcgcttcggttccaaggtccccggt
tccgcgatggaggtccgcgacgtgaacatggacttctcctactccgaggctttcaccgag
gagtcgcccgaggcctacgagcgtctcattctcgatgcgctgctcgacgagtccagcctc
ttccccaccaacgaggaggtcgagctgtcctgggcgatcctggacccgatcctggcctac
tgggcggagaacggtcagcccgaggagtacgagtccggcacgtggggcccggccggcgcc
gaccggatgctgcagcgttccggccgttcctggcggcgcccctaa

DBGET integrated database retrieval system