KEGG   Corynebacterium marinum: B840_07730Help
Entry
B840_07730        CDS       T03633                                 

Gene name
mtr
Definition
(GenBank) Mycothione reductase
  KO
K17883  mycothione reductase [EC:1.8.1.15]
Organism
cmq  Corynebacterium marinum
Brite
KEGG Orthology (KO) [BR:cmq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B840_07730 (mtr)
Enzymes [BR:cmq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.15  mycothione reductase
     B840_07730 (mtr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 K_oxygenase NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AJK69144
UniProt: A0A0B6TS91
Position
1596723..1598120
Genome map
AA seq 465 aa AA seqDB search
MTADLKVDKHYDLIIIGTGSGNSIPGPEFDDLSIAIVEKGTFGGTCLNVGCIPTKMFVHA
ADTALAARESGKLGLSSQVYHIDWPGIVSRVFDERIDLIAEGGEAYRRGPETPNIDVYDR
HARFVGERTLRTGQGEEEMTISGDRVIIAAGSRPMVPESIAESGVHFHTNDDIMRLPQQP
QSIIIVGGGFIAMEFAHVFDALGTKVHIVSRSGLLRRLDADLGSRINELAAKRYDVRVGR
TVADAVQDSRGITVTLDDGGTVTADVMLVATGRTRNGDQLDLDLGGVEMTDDGRVSVDEY
GRSTSAEGVWALGDVSSPYMLKHVANAEMRAVRHNLLHPDDLQKMPHENVPSAVFTNPQI
ATVGFTEREARRAGHNISVKIQKYGDVAYGWALEDTTGIAKLIADKDTGKLLGAHFLGPQ
ASTLVQQMITVMAFDLDVREVATKQYWIHPALPEVTENALLGLEF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgacctgaaggtcgacaagcactatgacctcatcatcatcggcaccggttcg
ggcaactcgattcccgggccggagttcgacgacctctcgatcgccatcgtggagaagggc
accttcggcggcacctgcctgaacgtgggctgcatcccgacgaagatgttcgtccacgcc
gccgacaccgcgctggccgcccgggagtccggcaagctggggctgagctcgcaggtgtac
cacatcgactggcccggaatcgtctcccgcgtgttcgacgagcgcatcgacctcatcgcg
gagggcggcgaggcctaccgccgcggcccggagaccccgaacatcgacgtctacgaccgg
cacgcccgcttcgtcggcgagcgcacgctgcgcaccggccagggcgaggaggagatgacc
atctccggcgaccgtgtcatcatcgccgccggttcccgccccatggtccccgagtccatc
gccgaatccggcgtgcacttccacaccaacgacgacatcatgcgcctgccgcagcagccc
cagtcgatcatcatcgtcggcggcggtttcatcgccatggagttcgcgcacgtcttcgac
gcgctcggcaccaaggtccacatcgtcagccgttccggcctcctgcggcgtctcgacgcc
gacctcggctcccgcatcaacgaactcgccgcgaaacgttacgacgtccgcgtcggccgc
accgtcgccgacgccgtccaggacagccgcggcatcaccgtcaccctcgacgacggcggc
accgtcaccgctgacgtcatgctcgtcgccaccggccgcacccggaacggcgaccagttg
gacctggacctcggcggagtggagatgaccgacgacggccgcgtcagcgtcgacgagtac
ggccgttccacctccgccgagggcgtgtgggcgctgggcgacgtgtcctcgccctacatg
ctcaagcacgtggccaacgccgagatgcgggccgtccgccacaacctgctccacccggac
gacctgcagaagatgccgcacgagaacgtgccctccgctgtgttcaccaacccgcagatc
gccaccgtcggcttcaccgagcgggaggcccgccgggccgggcacaacatctcggtgaag
atccagaagtacggcgacgtcgcctacggctgggcgctggaggacaccaccggcatcgcc
aagctcatcgccgacaaggacacgggcaaactgctcggcgcccacttcctcggccctcag
gcctccaccctcgtccagcagatgatcacggtcatggccttcgacctcgacgtccgcgag
gtggccaccaagcagtactggatccacccggcgctgcccgaggtgacggagaacgcgctg
ctgggcctggagttctag

DBGET integrated database retrieval system