KEGG   Corynebacterium marinum: B840_09615Help
Entry
B840_09615        CDS       T03633                                 

Gene name
phbA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cmq  Corynebacterium marinum
Pathway
cmq00071  Fatty acid degradation
cmq00072  Synthesis and degradation of ketone bodies
cmq00280  Valine, leucine and isoleucine degradation
cmq00310  Lysine degradation
cmq00362  Benzoate degradation
cmq00380  Tryptophan metabolism
cmq00620  Pyruvate metabolism
cmq00630  Glyoxylate and dicarboxylate metabolism
cmq00640  Propanoate metabolism
cmq00650  Butanoate metabolism
cmq00900  Terpenoid backbone biosynthesis
cmq01100  Metabolic pathways
cmq01110  Biosynthesis of secondary metabolites
cmq01120  Microbial metabolism in diverse environments
cmq01130  Biosynthesis of antibiotics
cmq01200  Carbon metabolism
cmq01212  Fatty acid metabolism
cmq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B840_09615 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    B840_09615 (phbA)
   00640 Propanoate metabolism
    B840_09615 (phbA)
   00650 Butanoate metabolism
    B840_09615 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B840_09615 (phbA)
   00072 Synthesis and degradation of ketone bodies
    B840_09615 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B840_09615 (phbA)
   00310 Lysine degradation
    B840_09615 (phbA)
   00380 Tryptophan metabolism
    B840_09615 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B840_09615 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B840_09615 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B840_09615 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmq04147]
    B840_09615 (phbA)
Enzymes [BR:cmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B840_09615 (phbA)
Exosome [BR:cmq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B840_09615 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Death
Motif
Other DBs
NCBI-ProteinID: AJK69514
UniProt: A0A0B6TTD2
Position
2001545..2002771
Genome map
AA seq 408 aa AA seqDB search
MTNPTDIVICSPLRTAVGAYGGQFTTVPVQDLAATVIRAIVERTGLSPEQVDDLILGQAS
PNGAAPALGRVVALDAGLGESVPGMQLDRRCGSGLQAVVTAAAHVAAGAADLIIAGGAES
MSRTEYTVDADVRWGKKGGNMVFRDRLAEARETAGGKNHPIPGGMIETAENLREEYSIPR
EAQDEMSVTSHARAVAAQENGTFAEEIVPVAVPQRKGDPLMVDTDEHPRPGSTMEKLAKL
RPIMGRQDADATVTAGNASGQNDGAAAMIVTTRAKAEELGLTPVVKLRGWAVAGVAPETM
GIGPVPATRKVLDRLGLTLDDMDLIELNEAFAAQALSVLSEWGISAEDPRLNPLGSGISL
GHPVGATGARMLVTASHQLQRTDAKTALITMCIGGGQGLAAVIEKEGN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccccaccgacatcgtgatctgctcccccctgcgcaccgccgtcggcgcctac
ggcgggcagttcaccaccgtgcccgtccaggacctcgccgccaccgtcatccgcgccatc
gtcgagcgcaccggcctctcccccgagcaggtcgacgacctcatcctcggccaggcctcc
cccaacggcgccgccccggccctgggccgcgtcgtcgccctcgacgccggcctgggcgag
tccgtcccaggcatgcagctcgaccgccgctgcggctccggcctgcaggccgtggtcacc
gccgccgcccacgtggccgccggcgcagccgacctgatcatcgccggtggcgccgagtcc
atgtcgcgcaccgagtacaccgtcgacgccgacgtccgctggggcaagaagggcggcaac
atggtcttccgcgaccgcctcgccgaggcccgcgagaccgccggcggaaagaaccacccg
atccccggcggcatgatcgagaccgccgaaaacctccgcgaggagtactccatcccccgc
gaggcccaggacgagatgtccgtgacctcccacgcccgcgccgtcgccgcgcaggagaac
ggcaccttcgccgaggagatcgtccccgtcgccgtcccgcagcgcaagggcgacccgctg
atggtcgacaccgacgagcacccccgccccggttccaccatggagaagctggccaagctc
cgcccgatcatgggccgacaggacgccgacgccaccgtcaccgcaggcaacgcctccggc
cagaacgacggcgccgccgccatgatcgtgaccacccgcgccaaggctgaggaactcggc
ctgacccccgtggtcaagctgcgcggctgggccgtcgccggcgtggcaccggagaccatg
ggcatcggcccggtcccggccaccaggaaggtcctcgaccgcctcggtctgaccctggac
gacatggacctcatcgaactcaacgaggccttcgccgctcaggccctgtccgtgctctcc
gagtggggcatctccgccgaggacccgcgcctcaacccgctgggctccggcatctccctg
ggccacccggtcggcgccaccggcgcccggatgctcgtcaccgcctcgcaccagctgcag
cgcaccgatgccaagaccgccctgatcaccatgtgcatcggcggcggccagggcctggcc
gccgtgatcgagaaggaggggaactaa

DBGET integrated database retrieval system