KEGG   Cyclobacterium marinum: Cycma_0180Help
Entry
Cycma_0180        CDS       T01592                                 

Definition
(GenBank) Glycoside hydrolase, family 20, catalytic core
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00511  Other glycan degradation
cmr00520  Amino sugar and nucleotide sugar metabolism
cmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cycma_0180
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cycma_0180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cmr03110]
    Cycma_0180
Enzymes [BR:cmr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cycma_0180
Chaperones and folding catalysts [BR:cmr03110]
 Intramolecular chaperones
  Others
   Cycma_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 CHB_HEX_C Glyco_hydro_20b CHB_HEX CHB_HEX_C_1 Fn3_assoc DUF2358
Motif
Other DBs
NCBI-ProteinID: AEL23963
UniProt: G0J1V7
Position
complement(216694..219306)
Genome map
AA seq 870 aa AA seqDB search
MNKITQIFTIIILINGFFACQTSPNWNETVDNIYIDWELKTNFTAEEGQFEAVFGIENQS
NHLLGEKDWALFFSMSPRGIVSTENADITHINGDWYKITPIKGFSLAPGERIEIPYVGIE
GVIKETDAPMGMYFVFYEEDGESEEIVAVNNVEVKPFVEDQQRLRGTMDKESPYSAESQY
DSNSQLVKLENEDLMPIIPTPFQVKKGEGDFIIDETITIGFEKGLSNEAEYLMDKLSELT
GEKFSMEEVSGIHAGIALKLEDIQVNGKSEEAYQLLIDQTGVTISGSDPAGVFYGLQSLL
ALLGNEAYLNQKLPLTLPYISIADAPRFGFRSLHMDVARNFQSKETIKKTLDIMSHYKLN
HFLFYTTEDEGWRVEIPGLPELTEVGAQREHTQSMDDPVVHPGYGSGPFAYEEGKNGSGF
YTREEFVDILEYAKARHITVIPVLNFPGHARAAIKSMEKRYLRLMEEGKKEEAEAYRLVD
PEDQSEYMSAQSFKDNVVNVASASTYDFYLKVVDELAKMYEDAGLELRKMHSGGDEVAEG
AWTASPQAKKLLESLPEISDPKNLQTYFFSTLLDKLADRDLEMHVWEEMVLLKDESGVYK
PNPDFAGKNVVPYIWNNMFDYPDLGYQLANMGYEVVLCNVSNFYFDLAYSNDPEEPGLYW
AGFVNTKNAWAFAPYDWFKTTYKTSMGEVIDREKDFKDMVRIDPAAKNNIIGLEAQLWTE
TVKGPEMAEYYMFPKMLGFAESAWAAERDWEKESDLKKMDQKITKGWNEFANRVGQTAFP
KLKWWNGGLNYRVAPPGAKVVDGKLHANVNFPGLEIRYTTDGTEPTIASNTYTGPIEINE
EVKLKVFDNTGKSSRSIVVAPKVWELRESK
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatcactcagatctttaccattataattctaataaatgggttttttgcctgc
caaacatctccgaattggaatgaaacggtggataatatttatatcgattgggaattaaaa
accaacttcacagcagaagaaggacagttcgaggctgtttttggaatagaaaatcaaagc
aatcatttgcttggcgaaaaagactgggcattattttttagcatgtcaccaagaggtata
gtctctactgaaaatgctgacatcactcatatcaatggagattggtataaaattactcct
atcaaaggtttttctttggcccccggagaacggatagaaattccttatgtggggattgaa
ggcgtgatcaaagaaacagatgctcctatgggtatgtattttgttttttatgaagaagat
ggggagtctgaagaaattgttgctgtaaataatgtagaagttaagccgtttgtggaggat
cagcagcgtttgagagggactatggataaagaatccccttattcagcagagagtcaatat
gatagcaattcccagttggtaaaattggaaaatgaagatttaatgcccattattcctact
cccttccaagtgaaaaaaggagagggtgattttattatcgatgaaaccattacaattggt
tttgaaaaagggctatccaatgaagctgaatacttaatggacaaattaagtgaactgaca
ggagaaaaattttcaatggaagaggtaagtggtattcatgccgggattgctttaaagctt
gaagatatccaagtcaacgggaaaagtgaagaagcttatcaattgttaattgaccaaaca
ggagttaccatttcagggagcgatcctgctggagtattttatggattgcaaagtttattg
gctcttttgggaaatgaagcttacttaaatcaaaaattgccattgactttaccttatata
agtattgctgatgcaccaagatttggtttcagaagtttacatatggacgtagcgagaaat
tttcaaagcaaagaaaccataaagaagacattggacatcatgtctcattataagttaaat
cattttcttttttatactactgaagatgaagggtggagggttgaaatccccggcttgccg
gaattgacagaagtaggcgcacaaagagaacatactcaaagcatggatgaccctgtggtt
cacccgggttatggatcaggtccatttgcttatgaagaaggaaaaaacgggagtggattt
tatactagagaagaatttgtggatattcttgaatatgctaaagcgcgacatataaccgtg
attccagtactcaactttccagggcatgcacgagcagcgatcaagtctatggaaaaaaga
tatttaagattaatggaggagggtaaaaaagaagaggcagaagcatatcgtttagtagat
cctgaagatcaatctgaatacatgtccgcgcaatcattcaaagacaatgtggtcaatgta
gctagtgcctcaacttatgatttttaccttaaagtagtagacgagttggcaaaaatgtat
gaggatgccggattggaactaaggaaaatgcattcaggaggagatgaagtggctgaagga
gcttggacagcttctcctcaagccaagaagcttttagaaagtttgcccgaaatcagtgac
ccaaaaaatctccaaacttacttttttagtaccctcttggataagttggcggatagggac
ttggaaatgcatgtgtgggaggagatggtactgttaaaagatgaatctggcgtttataaa
cccaatccggattttgcgggcaaaaacgttgtgccttatatatggaacaatatgtttgat
tatccggatctgggatatcaattagccaatatgggctatgaagtagttttatgtaatgtg
tccaatttttattttgatctggcctatagcaatgatcctgaagaaccgggcttatactgg
gcagggtttgtcaataccaagaatgcttgggcctttgctccgtatgattggttcaagact
acttataaaaccagtatgggggaagttattgatagggaaaaagattttaaagacatggtt
aggattgaccctgctgcgaaaaacaatattatcggtctggaagcacaattgtggacagaa
acggtaaaaggtcctgaaatggcagagtattacatgtttcctaagatgcttggttttgca
gagagtgcatgggcggctgaaagagattgggaaaaagaatctgacttgaagaaaatggat
caaaaaatcaccaagggctggaatgaatttgccaatagagttgggcaaacagcttttcca
aaactgaaatggtggaatggaggcttaaattaccgtgtggctcctcccggggcaaaagtt
gtggatggtaaactgcatgctaacgtaaatttcccaggcttggaaattcggtataccaca
gatgggacagaacctactattgcatcaaatacctatacaggacctatagaaataaatgaa
gaagtaaaattaaaggtttttgataatacaggtaaaagcagtaggtccatagtggtggct
ccaaaagtatgggagttgcgggaatcaaaataa

DBGET integrated database retrieval system