KEGG   Cyclobacterium marinum: Cycma_3113Help
Entry
Cycma_3113        CDS       T01592                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00260  Glycine, serine and threonine metabolism
cmr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cmr01100  Metabolic pathways
cmr01110  Biosynthesis of secondary metabolites
cmr01130  Biosynthesis of antibiotics
cmr01230  Biosynthesis of amino acids
Module
cmr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cycma_3113
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cycma_3113
Enzymes [BR:cmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cycma_3113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: AEL26841
UniProt: G0J689
Position
3644994..3645767
Genome map
AA seq 257 aa AA seqDB search
MNRIDELFKNKDGNILSIYFTAGFPNLDDTVGIMEAIEEAGADIIEIGIPYSDPVADGPT
IQDSNNVALNNGMTLKLLFTQLEGLRSKLNIPVVLMGYLNPIVQYGMDAFCKKCQEVGVD
GVIIPDLPMQQYTDSYKELFDNYNLRNTFLISPQTSEKRIREIDNKTDGFIYMVSSASIT
GAKKEVTPEQIAYFERVRDMGLKNPRLIGFGISDKASFTTASTYSHGAIIGSAFINVVKE
AKSLSEEIKTFIKGVIS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaatagacgaattatttaaaaataaggatggcaatatcctttctatatacttt
acagctggcttccctaatttggacgacaccgtcggaatcatggaagccatagaggaagca
ggggcagatattattgaaataggtataccctattctgaccctgttgccgatggtcctacc
attcaagatagcaacaatgttgccttgaacaatgggatgacactgaaattgttatttact
caattggagggattaagaagcaaattaaatattcctgtggtattgatggggtatctaaat
cctattgttcaatatggaatggatgcattctgcaaaaaatgtcaggaagtaggcgttgat
ggagtgattattcctgacttgccaatgcaacaatatactgattcctataaagaattgttt
gataattataaccttagaaacactttcttaatttctcctcagacttctgaaaaaaggatt
cgagaaatcgataacaagacagatggatttatctatatggtctcatctgcaagtattaca
ggagctaaaaaagaggttactccggagcaaatagcttatttcgagagggtaagggacatg
ggactaaaaaatccacgattgatcggttttggtatctcagacaaagcttcctttacaacc
gcctcaacttattcccatggagcaattattggaagtgctttcatcaatgttgtcaaggaa
gcaaaatcccttagtgaagaaatcaaaacatttataaaaggcgtcatatcatga

DBGET integrated database retrieval system