KEGG   Cyclobacterium marinum: Cycma_3197Help
Entry
Cycma_3197        CDS       T01592                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cycma_3197
Enzymes [BR:cmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Cycma_3197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AEL26925
UniProt: G0J734
Position
3752959..3753870
Genome map
AA seq 303 aa AA seqDB search
MNQGHKILVVGSANTDMVIRVEKFPAPGETLSGHNFLLNAGGKGANQAVAAARLGGKVAM
MARLGNDLFGKQTIENFKKEGLNVEGVVLDNKLPSGVAQIVVDKSGENTIVVAGGSNLAL
NTRQVNKYYSLVQEAEVILLQLEVPMETVLYVAQKATGLGKKVILNPAPANKLSDKLYAS
IYAITPNETETKFLTGINITGEKSAQHAADFFHDKGVKVVIITLGAAGAFLSTPDYSGTI
ATSEVEAVDTTAAGDTFNGALATALSNKMDWEEAVAFANKAASLSVTKHGAQASVPFLKD
LNV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagggacataaaatcctcgtggtaggaagtgcgaatacagacatggtcatcaga
gtagaaaaatttccggctccgggagaaacattatcgggacataattttttactaaatgca
ggaggaaaaggagccaatcaagccgttgccgctgcacggcttggaggcaaagttgccatg
atggctagattaggaaacgatctttttggaaaacaaaccattgagaattttaaaaaagaa
gggctgaatgtggaaggtgttgtacttgacaataaattaccttcaggtgtggctcaaatt
gtagttgacaagtctggagaaaataccatagtggtagcaggagggtctaatttggcttta
aatacaagacaggtcaataaatactatagcctagtgcaggaagccgaagtaattcttttg
cagttagaagtccctatggaaaccgttttatatgtagcacaaaaggccacaggtctggga
aagaaagtaattttgaatccggctccggctaataaactttcagataaactatatgcctca
atttatgccattaccccgaatgaaacagaaaccaaatttttgacaggtatcaatattacc
ggtgaaaaaagtgcgcaacatgcggcagattttttccatgacaaaggggttaaagtagtc
ataataaccctaggtgctgcaggtgcctttctttccacacccgattattccggtacaatt
gccacatctgaggtggaagcggtggatacgacagctgcaggggacactttcaatggtgcc
ttggccactgctttatccaacaagatggattgggaagaggcagtagcctttgccaataag
gctgcttctttgtctgtgaccaaacatggagcgcaagcctctgtaccatttttgaaagac
ctcaatgtctaa

DBGET integrated database retrieval system