KEGG   Cyclobacterium marinum: Cycma_4546Help
Entry
Cycma_4546        CDS       T01592                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00240  Pyrimidine metabolism
cmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cycma_4546
Enzymes [BR:cmr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Cycma_4546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AEL28235
UniProt: G0J1M6
Position
complement(5507432..5508997)
Genome map
AA seq 521 aa AA seqDB search
MAFTTAQTQSNYNIVMEEKRREHFELRLVRLDIDSRNEYMVFMRKDCPVCISEGFEALNR
IRVTKDNKTLVASLIVWDNETQLRHDQLGLSNAAIDALGAIEGEPLSLSHLDALDSMGNV
RKKIYGNRLNQGEFDTIVKDIVNRNLSNLQLSAFLASCTGDSLNKEEVIALTKSMINIGY
KLEWDELNIYDKHCIGGLPGNRTTPIVVAIVAAAGLIIPKTSSRAITSPAGTADTMEVMT
NVNLTIAQMKKVVKQEGGCLAWGGSVQLSPADDILIRVEKALDIDSEGQMIASVLSKKAA
AGSTDVVIDIPVGPTAKVRSQLAAEHLSEKMIAVGKAIGLNIEIVLSDGFQPVGRGIGPS
LEAKDVLAVLRNEKNAPADLRERAVILAGELLEMAGMAVVGTGEFKALKIIRNGTAYDKF
LAICKAQGHFKEPGIATLKHPVYSNQKGRVFEIDNRRLAKVAKLAGAPSVKTAGVLLYIS
LGSAVKKNDIIFEIHAESKGELEYALSYLNTQKEIIKIKES
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggccttcacaactgcccaaactcaatcaaactataacattgtgatggaagaaaaaagg
agggaacatttcgaattgcgattagttaggctggacattgattcacgcaatgagtacatg
gtatttatgcgtaaagattgtccggtttgtatttcagaaggttttgaagctttgaatagg
attcgagttacaaaagacaataaaaccctcgttgcatctctcattgtatgggacaatgaa
acacaattaaggcacgatcaacttgggctttcaaatgctgcaatagatgcattgggggct
atagaaggggagccactttccctgagccatttagatgcccttgattcaatgggcaatgtt
cgtaaaaaaatttatggaaatcggttgaaccagggagagtttgatactattgtaaaagat
attgtcaatcggaatctttcaaaccttcaactttcagcattccttgcctcctgtactggt
gattcgcttaataaagaggaagtaattgcgctcacaaaatcaatgatcaatattggatac
aaattggaatgggatgaattgaatatatatgacaaacattgcattggagggcttcctggt
aatagaacaacgccaatagtagtcgccatcgtagcggctgcgggactcattatccctaaa
acctcatccagggccataacatcaccagcaggtacggcagataccatggaagtgatgacc
aatgtaaaccttaccatagcgcaaatgaaaaaagtggtaaagcaggaaggtggttgcctg
gcctggggcggatcagtacagcttagtccagctgatgatatacttatccgtgtagaaaaa
gcattagatattgatagcgaagggcagatgatcgcttctgtgctttctaaaaaggcagca
gctggttctaccgatgtagtcattgatattcccgttgggcctactgccaaagttcgttct
cagttagctgctgagcatttatcagaaaaaatgattgcagtaggtaaagccatagggctg
aatatagaaattgtgttgtctgatggttttcagcccgtaggacgaggtatcggcccttca
cttgaggccaaagatgttttggccgtattgaggaatgagaagaatgctccagctgatctt
agggaaagagctgtaatcttagctggcgaattattggaaatggccggtatggccgtggta
ggcactggggaatttaaagccttgaaaataataagaaacggaactgcttacgacaaattt
ctggcaatatgtaaggcacaagggcattttaaggagcccggaattgctactcttaaacat
cctgtttattccaatcagaaagggagggtttttgaaattgataaccgcagactggctaaa
gttgccaagctagcaggagcaccgagtgttaagaccgccggagttctactctatatctct
ttaggtagtgctgttaaaaagaatgacattatatttgaaattcacgcagagtcaaagggg
gagcttgagtacgctctttcttacctaaacacccaaaaggaaattattaaaatcaaagaa
tcatga

DBGET integrated database retrieval system