KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS1813
Entry
CMS1813           CDS       T00678                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
cms00330  Arginine and proline metabolism
cms00332  Carbapenem biosynthesis
cms01100  Metabolic pathways
cms01110  Biosynthesis of secondary metabolites
cms01230  Biosynthesis of amino acids
Module
cms_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cms00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CMS1813 (proB)
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CMS1813 (proB)
Enzymes [BR:cms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CMS1813 (proB)
SSDB
Motif
Pfam: AA_kinase
Other DBs
NCBI-ProteinID: CAQ01918
UniProt: B0RDG2
Position
complement(1915849..1916628)
AA seq 259 aa
MGTASRAGIASARRIVVKVGSSSISGENAGQIAPLVDAIAAAHARGAEVVLVSSGAIATG
MPFLRLDDRPADLATQQAAAAVGQSVLIFRYQESLDRYGIVAGQVLLTAGDLAAPDHREN
AQRAMERLLGLRLLPVVNENDTVATHEIRFGDNDRLAALVARLVDADLLLLLSDVDALYS
RPPEEPGARRIEHVAFGDELEGVEIGSTGTGVGTGGAVTKVAAARLAAEAGTGVLLTSTA
QVAEALAGAHVGTWFAPRS
NT seq 780 nt   +upstreamnt  +downstreamnt
atgggcacggcctcgcgcgcgggcattgcgtccgcgcggcgcatcgtcgtgaaggtcggc
tcgtcctccatcagcggggagaacgccgggcagatcgcgcccctcgtggacgcgatcgcc
gccgcgcacgcgcgcggcgccgaggtcgtgctcgtgtcctccggcgccatagccaccggc
atgccgttcctccgcctggacgaccgcccagcagacctcgccacccagcaggccgcggcc
gcggtcggccagagcgtgctgatcttccgctaccaggagagcctcgaccgctacgggatc
gtcgcgggccaggtgctgctcacggccggcgacctcgcggcccccgaccaccgggagaac
gcgcagcgcgccatggagcggctgctcgggctgcggctgctgcccgtcgtcaacgagaac
gacaccgtggcgacgcacgagatccgcttcggcgacaacgaccggctggccgccctcgtg
gcccggctggtggacgccgacctgctgctcctgctctcggatgtggacgcgctctacagc
cgcccgccggaagagcccggtgcccggcgcatcgagcacgtggcgttcggcgacgagctc
gagggcgtcgagatcggcagcacgggcacaggcgtcggcaccgggggagcggtgaccaag
gtcgccgccgcgcgcctcgcagccgaggcgggcacgggggtcctcctcacgtcgaccgcg
caggtcgccgaggccctcgccggcgcgcacgtcggcacgtggttcgcgccccgcagctga

DBGET integrated database retrieval system